DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42537 and scl-8

Sequence 1:NP_001163530.1 Gene:CG42537 FlyBaseID:FBgn0260645 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_502510.1 Gene:scl-8 WormBaseID:WBGene00008030 Length:210 Species:Caenorhabditis elegans

Alignment Length:95 Identity:24/96 (25%)
Similarity:35/96 (36%) Gaps:27/96 (28%)


  Fly     1 MKLLLVL--ACVVLYVSLACGQNRCDGRPRGRLSCEGGKNEGFGGRHCRRTAMDEMWYYNQRTRK 63
            |:.||||  |||.:|...:                ||||.......:..|:.:.:..|..:..||
 Worm     1 MRTLLVLAVACVGVYAQFS----------------EGGKQSILNAHNDIRSRIAKGNYVAKGNRK 49

  Fly    64 -----CLKMKYLG----CGGNQNRYCSLRH 84
                 .||||:..    ...|....|.::|
 Worm    50 ESATNMLKMKWDSSLEQSAQNYANGCHMQH 79

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42537NP_001163530.1 KU <53..89 CDD:294074 10/42 (24%)
scl-8NP_502510.1 SCP 22..175 CDD:214553 13/59 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.