DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42537 and crisp1

Sequence 1:NP_001163530.1 Gene:CG42537 FlyBaseID:FBgn0260645 Length:90 Species:Drosophila melanogaster
Sequence 2:XP_002933627.1 Gene:crisp1 XenbaseID:XB-GENE-5838744 Length:237 Species:Xenopus tropicalis

Alignment Length:79 Identity:19/80 (24%)
Similarity:25/80 (31%) Gaps:37/80 (46%)


  Fly    17 ACGQNRCDGRPRGRLSCEGGKNEGFGGRHCRRTAMDEMWYYNQRTRKC-LKMKYLGCGGNQNRYC 80
            |||.  |.|      :|:.|.        |              |..| .:..|.|| .|...||
 Frog   182 ACGD--CPG------ACDNGL--------C--------------TNPCPYQDMYSGC-SNYIAYC 215

  Fly    81 SL-----RHCQRSC 89
            :|     ..|:.:|
 Frog   216 NLIPTITNGCRGTC 229

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42537NP_001163530.1 KU <53..89 CDD:294074 10/42 (24%)
crisp1XP_002933627.1 SCP_CRISP 32..165 CDD:240183
Crisp 183..236 CDD:285731 18/79 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.