powered by:
Protein Alignment: CG42537 and crisp1
| Sequence 1: | NP_001163530.1 |
Gene: | CG42537 |
FlyBaseID: | FBgn0260645 |
Length: | 90 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_002933627.1 |
Gene: | crisp1 |
XenbaseID: | XB-GENE-5838744 |
Length: | 237 |
Species: | Xenopus tropicalis |
| Alignment Length: | 79 |
Identity: | 19/80 (24%) |
| Similarity: | 25/80 (31%) |
Gaps: | 37/80 (46%) |
|
Fly 17 ACGQNRCDGRPRGRLSCEGGKNEGFGGRHCRRTAMDEMWYYNQRTRKC-LKMKYLGCGGNQNRYC 80
|||. |.| :|:.|. | |..| .:..|.|| .|...||
Frog 182 ACGD--CPG------ACDNGL--------C--------------TNPCPYQDMYSGC-SNYIAYC 215
Fly 81 SL-----RHCQRSC 89
:| ..|:.:|
Frog 216 NLIPTITNGCRGTC 229
|
Known Domains:
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG42537 | NP_001163530.1 |
KU |
<53..89 |
CDD:294074 |
10/42 (24%) |
| crisp1 | XP_002933627.1 |
SCP_CRISP |
32..165 |
CDD:240183 |
|
| Crisp |
183..236 |
CDD:285731 |
18/79 (23%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
|
|
|
E1_COG2340 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
|
|
|
D1528782at2759 |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.
