powered by:
Protein Alignment CG42498 and LOC690348
DIOPT Version :9
| Sequence 1: | NP_001163743.1 |
Gene: | CG42498 / 8674046 |
FlyBaseID: | FBgn0260224 |
Length: | 111 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_001074179.2 |
Gene: | LOC690348 / 690348 |
RGDID: | 1597340 |
Length: | 208 |
Species: | Rattus norvegicus |
| Alignment Length: | 75 |
Identity: | 18/75 - (24%) |
| Similarity: | 37/75 - (49%) |
Gaps: | 0/75 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 11 ESIIRVPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLENDVLVVHFQSDQVKSLRTAITSFFEC 75
|..:.|||.|...|::|.:.|..:...::..|::..::.:.:|.|.:.::.....|.:|.||.:.
Rat 117 EFSVTVPFRTAVEADMARRSLVANARRQQVMVQQEFTVNDSILAVRWTTEDPVLFRISINSFLDQ 181
Fly 76 LLLCQDTINQ 85
|.|....|.:
Rat 182 LSLVMRNIQR 191
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG42498 | NP_001163743.1 |
Pcc1 |
14..84 |
CDD:286431 |
16/69 (23%) |
| LOC690348 | XP_001074179.2 |
Pcc1 |
118..190 |
CDD:286431 |
16/71 (23%) |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C166350516 |
| Domainoid |
1 |
1.000 |
46 |
1.000 |
Domainoid score |
I11781 |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
O |
PTHR31283 |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.030 |
|
Return to query results.
Submit another query.