DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42498 and LOC690348

DIOPT Version :8

Sequence 1:NP_001163743.1 Gene:CG42498 / 8674046 FlyBaseID:FBgn0260224 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_001074179.2 Gene:LOC690348 / 690348 RGDID:1597340 Length:208 Species:Rattus norvegicus

Alignment Length:75 Identity:18/76 (24%)
Similarity:37/76 (49%) Gaps:0/76 (0%)


  Fly    11 ESIIRVPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLENDVLVVHFQSDQVKSLRTAITSFFEC 75
            |..:.|||.|...|::|.:.|..:...::..|::..::.:.:|.|.:.::.....|.:|.||.:.
  Rat   117 EFSVTVPFRTAVEADMARRSLVANARRQQVMVQQEFTVNDSILAVRWTTEDPVLFRISINSFLDQ 181

  Fly    76 LLLCQDTINQ 85
            |.|....|.:
  Rat   182 LSLVMRNIQR 191

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42498NP_001163743.1 Pcc1 14..84 CDD:286431 17/70 (24%)
LOC690348XP_001074179.2 Pcc1 118..190 CDD:286431 17/72 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C281441600
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001216
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR31283
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.