DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42498 and Lage3

DIOPT Version :8

Sequence 1:NP_001163743.1 Gene:CG42498 / 8674046 FlyBaseID:FBgn0260224 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_079686.1 Gene:Lage3 / 66192 MGIID:1913442 Length:148 Species:Mus musculus

Alignment Length:72 Identity:28/73 (38%)
Similarity:38/73 (52%) Gaps:0/73 (0%)


  Fly    16 VPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLENDVLVVHFQSDQVKSLRTAITSFFECLLLCQ 80
            |||.|...||||...|..|.||.|..|.|.|.:...:|.|.:.::..:.||.:|.:|.:.|.|..
Mouse    72 VPFPTSLEAEIACGSLVPDVEPHRGLVGKELKVSGCMLEVRWIAEDSRLLRLSIINFLDQLSLVV 136

  Fly    81 DTINQFG 87
            :||..||
Mouse   137 NTIQLFG 143

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42498NP_001163743.1 Pcc1 14..84 CDD:286431 26/68 (38%)
Lage3NP_079686.1 Pcc1 68..140 CDD:286431 26/68 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C281438095
eggNOG 1 0.900 E1_2CZV3
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001216
OrthoInspector 1 1.000 T1082439
orthoMCL 1 0.900 OOG5_134656
Panther 1 1.100 LDO PTHR31283
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7158
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.