powered by:
Protein Alignment CG42498 and Lage3
DIOPT Version :9
| Sequence 1: | NP_001163743.1 |
Gene: | CG42498 / 8674046 |
FlyBaseID: | FBgn0260224 |
Length: | 111 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_079686.1 |
Gene: | Lage3 / 66192 |
MGIID: | 1913442 |
Length: | 148 |
Species: | Mus musculus |
| Alignment Length: | 72 |
Identity: | 28/72 - (38%) |
| Similarity: | 38/72 - (52%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 16 VPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLENDVLVVHFQSDQVKSLRTAITSFFECLLLCQ 80
|||.|...||||...|..|.||.|..|.|.|.:...:|.|.:.::..:.||.:|.:|.:.|.|..
Mouse 72 VPFPTSLEAEIACGSLVPDVEPHRGLVGKELKVSGCMLEVRWIAEDSRLLRLSIINFLDQLSLVV 136
Fly 81 DTINQFG 87
:||..||
Mouse 137 NTIQLFG 143
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C167847007 |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CZV3 |
| Hieranoid |
1 |
1.000 |
- |
- |
|
|
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0005842 |
| OrthoInspector |
1 |
1.000 |
- |
- |
|
oto94198 |
| orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_104774 |
| Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR31283 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R7158 |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
9 | 8.770 |
|
Return to query results.
Submit another query.