DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42498 and SPAC4H3.13

DIOPT Version :8

Sequence 1:NP_001163743.1 Gene:CG42498 / 8674046 FlyBaseID:FBgn0260224 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_594349.1 Gene:SPAC4H3.13 / 2543415 PomBaseID:SPAC4H3.13 Length:88 Species:Schizosaccharomyces pombe

Alignment Length:84 Identity:23/84 - (27%)
Similarity:46/84 - (54%) Gaps:0/84 - (0%)


  Fly     2 MPQIANKPNESIIRVPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLENDVLVVHFQSDQVKSLR 66
            |.::...|::..::||..:...||...:||..|:|.:...|::.|.::::.|||::.....:..|
pombe     1 MSEMIVLPHKVTVKVPLASRVDAERCLQVLAPDRELKEELVQRNLFVDDNYLVVNYSCSSARMTR 65

  Fly    67 TAITSFFECLLLCQDTINQ 85
            ..:.|.||.|.|..||:::
pombe    66 VTVNSLFENLYLIIDTMHE 84

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42498NP_001163743.1 Pcc1 14..84 CDD:286431 21/69 (30%)
SPAC4H3.13NP_594349.1 Pcc1 11..83 CDD:286431 21/71 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2051
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001216
OrthoInspector 1 1.000 T1124300
orthoMCL 1 0.900 OOG5_134656
Panther 1 1.100 LDO PTHR31283
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7158
TreeFam 00.000 Not matched by this tool.
77.080

Return to query results.
Submit another query.