DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tcs6 and pcc1

DIOPT Version :10

Sequence 1:NP_001163743.1 Gene:Tcs6 / 8674046 FlyBaseID:FBgn0260224 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_594349.1 Gene:pcc1 / 2543415 PomBaseID:SPAC4H3.13 Length:88 Species:Schizosaccharomyces pombe


Alignment Length:84 Identity:23/84 - (27%)
Similarity:46/84 - (54%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MPQIANKPNESIIRVPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLENDVLVVHFQSDQVKSLR 66
            |.::...|::..::||..:...||...:||..|:|.:...|::.|.::::.|||::.....:..|
pombe     1 MSEMIVLPHKVTVKVPLASRVDAERCLQVLAPDRELKEELVQRNLFVDDNYLVVNYSCSSARMTR 65

  Fly    67 TAITSFFECLLLCQDTINQ 85
            ..:.|.||.|.|..||:::
pombe    66 VTVNSLFENLYLIIDTMHE 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tcs6NP_001163743.1 Pcc1 14..84 CDD:462764 21/69 (30%)
pcc1NP_594349.1 Pcc1 10..82 CDD:462764 20/71 (28%)

Return to query results.
Submit another query.