DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42498 and CTAG1A

DIOPT Version :8

Sequence 1:NP_001163743.1 Gene:CG42498 / 8674046 FlyBaseID:FBgn0260224 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_640343.1 Gene:CTAG1A / 246100 HGNCID:24198 Length:180 Species:Homo sapiens

Alignment Length:70 Identity:18/71 (25%)
Similarity:34/71 (48%) Gaps:2/71 (3%)


  Fly    11 ESIIRVPFETPRLAEIAYKVLGVDQEPR--RNFVKKTLSLENDVLVVHFQSDQVKSLRTAITSFF 73
            |..:.:||.||..||:|.:.|..|..|.  ...:.|..::..::|.:...:...:.|:.:|:|..
Human    89 EFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCL 153

  Fly    74 ECLLL 78
            :.|.|
Human   154 QQLSL 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42498NP_001163743.1 Pcc1 14..84 CDD:286431 17/68 (25%)
CTAG1ANP_640343.1 Pcc1 92..162 CDD:312741 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C281442158
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5350
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001216
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR31283
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.080

Return to query results.
Submit another query.