DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tcs6 and CTAG1A

DIOPT Version :10

Sequence 1:NP_001163743.1 Gene:Tcs6 / 8674046 FlyBaseID:FBgn0260224 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_640343.1 Gene:CTAG1A / 246100 HGNCID:24198 Length:180 Species:Homo sapiens


Alignment Length:70 Identity:18/70 - (25%)
Similarity:34/70 - (48%) Gaps:2/70 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ESIIRVPFETPRLAEIAYKVLGVDQEPR--RNFVKKTLSLENDVLVVHFQSDQVKSLRTAITSFF 73
            |..:.:||.||..||:|.:.|..|..|.  ...:.|..::..::|.:...:...:.|:.:|:|..
Human    89 EFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCL 153

  Fly    74 ECLLL 78
            :.|.|
Human   154 QQLSL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tcs6NP_001163743.1 Pcc1 14..84 CDD:462764 17/67 (25%)
CTAG1ANP_640343.1 Pcc1 89..164 CDD:462764 18/70 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..66
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.