DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42498 and LOC102552182

DIOPT Version :8

Sequence 1:NP_001163743.1 Gene:CG42498 / 8674046 FlyBaseID:FBgn0260224 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_006227268.1 Gene:LOC102552182 / 102552182 RGDID:7585162 Length:198 Species:Rattus norvegicus

Alignment Length:85 Identity:20/85 - (23%)
Similarity:41/85 - (48%) Gaps:2/85 - (2%)


  Fly    11 ESIIRVPFETPRLAEIAYKVLGVDQEPRRNFVKKTLSLENDVLVVHFQSDQVKSLRTAITSFFEC 75
            |..:||||.:...|::|.:.|..:.:.:...|.:..::.:.:|.|.:.::.....|.:|.:|.:.
  Rat   108 EFSVRVPFSSAVEADMARRSLVANAQRQLLMVPQEYTVNDSILAVRWTTEDPLLFRISINNFLDQ 172

  Fly    76 LLLCQDTIN--QFGDSKKEK 93
            |.|....|.  ||...|:.:
  Rat   173 LSLVMRNIQHLQFVAFKRRR 192

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42498NP_001163743.1 Pcc1 14..84 CDD:286431 15/69 (22%)
LOC102552182XP_006227268.1 Pcc1 109..181 CDD:286431 15/71 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C281441726
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR31283
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.