DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42598 and CG41284

Sequence 1:NP_001163857.2 Gene:CG42598 FlyBaseID:FBgn0260997 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001104417.3 Gene:CG41284 FlyBaseID:FBgn0085599 Length:340 Species:Drosophila melanogaster

Alignment Length:340 Identity:339/341 (99%)
Similarity:339/341 (99%) Gaps:0/341 (0%)


  Fly     1 MTGTNMVFVIKWYIAFFFAASIFAMSCNGHGRLVEPPGRASAWRFGFQTPPDYNDHELNCGGLSR 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MTGTNMVFVIKWYIAFFFAASIFAMSCNGHGRLVEPPGRASAWRFGFQTPPDYNDHELNCGGLSR 65

  Fly    66 QWQRNGGKCGECGDAWDLPEPRPHEYGGHWGKGQIVRSYLPGSQMTIRVELTASHMGYFEFRICP 130
            ||||.||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 QWQRYGGKCGECGDAWDLPEPRPHEYGGHWGKGQIVRSYLPGSQMTIRVELTASHMGYFEFRICP 130

  Fly   131 NPNAKQSCLDENVLSILNGSPSQPNESDLDTRFYPRNGSCIYEILAQLPDFTCEHCVLQWRYVAG 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 NPNAKQSCLDENVLSILNGSPSQPNESDLDTRFYPRNGSCIYEILAQLPDFTCEHCVLQWRYVAG 195

  Fly   196 NNWGMCGNGIGAIGCGPQEEFRSCSDIALTTEYLHPYLSPINPPPSQSNGMSANTKHNTVNIQSY 260
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   196 NNWGMCGNGIGAIGCGPQEEFRSCSDIALTTEYLHPYLSPINPPPSQSNGMSANTKHNTVNIQSY 260

  Fly   261 KLKYICIILLLLILILVCVVVMSIKFHNHNSFCIPQFCNNQKKYLFWNSSQHNNFICDLFKKNIT 325
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   261 KLKYICIILLLLILILVCVVVMSIKFHNHNSFCIPQFCNNQKKYLFWNSSQHNNFICDLFKKNIT 325

  Fly   326 LSNDKLDDPVHKLGD 340
            |||||||||||||||
  Fly   326 LSNDKLDDPVHKLGD 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42598NP_001163857.2 Chitin_bind_3 30..222 CDD:281112 191/192 (99%)
CG41284NP_001104417.3 Chitin_bind_3 30..222 CDD:281112 191/192 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131060605
eggNOG 1 0.900 E1_28N9R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21113
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.