DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42598 and CG4362

DIOPT Version :9

Sequence 1:NP_001163857.2 Gene:CG42598 / 8674042 FlyBaseID:FBgn0260997 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_650876.1 Gene:CG4362 / 42410 FlyBaseID:FBgn0038784 Length:233 Species:Drosophila melanogaster


Alignment Length:222 Identity:88/222 - (39%)
Similarity:136/222 - (61%) Gaps:19/222 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IKWYIAFFFAASIFAMSCNGHGRLVEPPGRASAWRFGFQTPPDYNDHELNCGGLSRQWQRNGGKC 74
            :|:.::.....:|.....:.||.::.||.|:|.||:....|.::||:||.||||..| ..|||:|
  Fly     1 MKYLLSMTLLLAIGLQQIDAHGMMLSPPSRSSRWRYDGSAPQNWNDNELFCGGLYTQ-SNNGGRC 64

  Fly    75 GECGDAWDLPEPRPHEYGGH-WGKGQIVRSYLPGSQMTIRVELTASHMGYFEFRICPNPNA---- 134
            |.|||.:...:||.:|.||. .|.|.:.|||:.|:.:|:.|::|.:|:|||||.:| |.:|    
  Fly    65 GLCGDNFLDAQPRANEIGGSIGGAGVVTRSYVAGNTITVGVKITTNHLGYFEFHLC-NLDAFGAE 128

  Fly   135 KQSCLDENVLSILNGSPSQPNESDLDTRFYPRNGSCIYEILAQLPD-FTCEHCVLQWRYVAGNNW 198
            .:.|.|:|.|..::||    :..|:..:.    |.  :::...||: .||.||||:|.||..|||
  Fly   129 SEECFDQNRLRFIDGS----DRKDIGDQM----GE--FDVTVVLPEGLTCSHCVLRWTYVGANNW 183

  Fly   199 GMCGN-GIGAIGCGPQEEFRSCSDIAL 224
            |:|.| |.||:||||||.|::|:|:::
  Fly   184 GICDNSGNGALGCGPQETFKNCADVSI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42598NP_001163857.2 Chitin_bind_3 30..222 CDD:281112 85/198 (43%)
CG4362NP_650876.1 Chitin_bind_3 21..208 CDD:281112 85/198 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447019
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283095at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.