| Sequence 1: | NP_001163857.2 | Gene: | CG42598 / 8674042 | FlyBaseID: | FBgn0260997 | Length: | 340 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001287421.2 | Gene: | CG4367 / 42409 | FlyBaseID: | FBgn0038783 | Length: | 230 | Species: | Drosophila melanogaster |
| Alignment Length: | 200 | Identity: | 84/200 - (42%) |
|---|---|---|---|
| Similarity: | 122/200 - (61%) | Gaps: | 15/200 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 29 GHGRLVEPPGRASAWRFGFQTPPDYNDHELNCGGLSRQWQRNGGKCGECGDAWDLPEPRPHEYGG 93
Fly 94 HWGKGQIVRSYLPGSQMTIRVELTASHMGYFEFRIC---PNPNAKQSCLDENVLSILNGSPSQPN 155
Fly 156 ESDLDTRFYPRNGSCIYEILAQLP-DFTCEHCVLQWRYVAGNNWGMCGNGIGAIGCGPQEEFRSC 219
Fly 220 SDIAL 224 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42598 | NP_001163857.2 | Chitin_bind_3 | 30..222 | CDD:281112 | 81/195 (42%) |
| CG4367 | NP_001287421.2 | LPMO_10 | 24..209 | CDD:335201 | 81/195 (42%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45447022 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1283095at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR21113 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.950 | |||||