DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42598 and CG4367

Sequence 1:NP_001163857.2 Gene:CG42598 FlyBaseID:FBgn0260997 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001287421.2 Gene:CG4367 FlyBaseID:FBgn0038783 Length:230 Species:Drosophila melanogaster

Alignment Length:200 Identity:84/200 (42%)
Similarity:122/200 (61%) Gaps:15/200 (8%)


  Fly    29 GHGRLVEPPGRASAWRFGFQTPPDYNDHELNCGGLSRQWQRNGGKCGECGDAWDLPEPRPHEYGG 93
            |||.::.|.||:|.||:....|.:|:|:.|.|||..:|.: |.||||.|||.|.|.:|||:|.||
  Fly    23 GHGMMLSPTGRSSRWRYDNSAPTNYDDNALYCGGFWKQTE-NDGKCGLCGDDWSLEQPRPNELGG 86

  Fly    94 HWGKGQIVRSYLPGSQMTIRVELTASHMGYFEFRIC---PNPNAKQSCLDENVLSILNGSPSQPN 155
            .:|.|.||:|:....:..|.|::||:|:|||.|.||   .|.:..:.|.::..|:..:||     
  Fly    87 KYGSGVIVKSFAGVDEAEINVKITANHLGYFRFHICDLDENGSESEDCFNQYPLNFTDGS----- 146

  Fly   156 ESDLDTRFYPRNGSCIYEILAQLP-DFTCEHCVLQWRYVAGNNWGMCGNGIGAIGCGPQEEFRSC 219
                 .::|....:....:..:|| |..|.||||:|.|.||||||:|.:|.||:|||.||.|.:|
  Fly   147 -----QKYYINTTTGDIPVTVKLPSDLNCIHCVLRWTYTAGNNWGVCEDGTGAMGCGAQETFINC 206

  Fly   220 SDIAL 224
            :||::
  Fly   207 ADISV 211

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42598NP_001163857.2 Chitin_bind_3 30..222 CDD:281112 82/196 (42%)
CG4367NP_001287421.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131060728
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21113
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.