DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42456 and dpm2

DIOPT Version :8

Sequence 1:NP_001163338.1 Gene:CG42456 / 8674033 FlyBaseID:FBgn0259933 Length:81 Species:Drosophila melanogaster
Sequence 2:NP_001016297.1 Gene:dpm2 / 549051 XenbaseID:XB-GENE-1003154 Length:84 Species:Xenopus tropicalis

Alignment Length:68 Identity:23/69 (33%)
Similarity:37/69 (54%) Gaps:3/69 (4%)


  Fly    10 IILISAIAVFFYYFFWVAVLPFMLIDEGNPIRLFFPPLKYAFIVPTVFGVIFLGGIAAFSFYHIW 74
            ::.:|:| :|.||..||.:|||  ||..:.|..||...:||.::|....::.|..|..|..:.:|
 Frog    13 LVALSSI-IFVYYSVWVILLPF--IDSDHVIHNFFLSREYAVLLPLSAALVLLFFIGIFVTFIMW 74

  Fly    75 SLR 77
            ..|
 Frog    75 KSR 77

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42456NP_001163338.1 DPM2 3..68 CDD:284664 20/58 (34%)
dpm2NP_001016297.1 DPM2 5..80 CDD:284664 23/69 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005329
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.