DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42556 and CSF1

DIOPT Version :9

Sequence 1:NP_001162994.1 Gene:CG42556 / 8674031 FlyBaseID:FBgn0260758 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_013188.1 Gene:CSF1 / 850776 SGDID:S000004077 Length:2958 Species:Saccharomyces cerevisiae


Alignment Length:282 Identity:52/282 - (18%)
Similarity:96/282 - (34%) Gaps:106/282 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TVIQG--------LSTRHGQIISHIRRSSGSSS-----------------FPELAFFDDLDDMEP 45
            :|::|        |:.|..::|.:.:.|||..:                 :.....:|::.::..
Yeast    93 SVLEGSLTWKYWLLNCRKAELIENNKSSSGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLS 157

  Fly    46 EDE----EGVMN-HQYPILHSRHSDLFYMPNCVGPAYQGLISSL-DQPYTTDCYMADEQTLVKEN 104
            :||    |..:| |.:|           .|...|.:...|...| :..|||:    .:.::|.:.
Yeast   158 KDERDKFEKYLNEHSFP-----------EPFSDGSSADKLDEDLSESAYTTN----SDASIVNDR 207

  Fly   105 D----------------------SIHDTILESLVAPTEMCV----------VACPKLLLTYMRRL 137
            |                      |....:|.:...|:.|.:          |..||..|...|..
Yeast   208 DYQETDIGKHPKLLMFLPIELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNK 272

  Fly   138 FQHPYARFGSSMNFSM-----IGLRFK-DK-DANKALTSFVHFASYNSREIM------------D 183
            .|..:..|..|:..::     |||:|| |: ..:|...:||......::.::            |
Yeast   273 TQMEFKNFEISIKQNIGYDDAIGLKFKIDRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTSDD 337

  Fly   184 NGY--WADFINPLTGRAYYRAA 203
            |.|  |       .|.:.|:|:
Yeast   338 NFYHKW-------KGLSLYKAS 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42556NP_001162994.1 DUF2246 <117..248 CDD:287231 26/118 (22%)
CSF1NP_013188.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.