DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42556 and KIAA1109

Sequence 1:NP_001162994.1 Gene:CG42556 FlyBaseID:FBgn0260758 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_011530621.1 Gene:KIAA1109 HGNCID:26953 Length:5093 Species:Homo sapiens

Alignment Length:123 Identity:23/124 (19%)
Similarity:51/124 (41%) Gaps:43/124 (35%)


  Fly   102 KENDSI-------------HDTILESLVAPTEMCVVACPKLL-LTY-------------MRRLFQ 139
            ::|:||             |::.:..|:..|   :::|..:: |||             :.||::
Human     4 RKNESIVPSITQLEDFLTEHNSNVVWLLVAT---ILSCGWIIYLTYYNSRNVGLILTLVLNRLYK 65

  Fly   140 HPYARFGSSMNFSMIGLRFKDKDANKALTSFVHFASYNSREIMDNGY----WADFINP 193
            |.|...| |.:||::        :.|.:...:::.:.:....:.:|:    |....||
Human    66 HGYIHIG-SFSFSVL--------SGKVMVREIYYITEDMSIRIQDGFIIFRWWKMYNP 114

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42556NP_001162994.1 DUF2246 <117..248 CDD:287231 18/96 (19%)
KIAA1109XP_011530621.1 FSA_C 4468..5075 CDD:287455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.