DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42556 and si:ch211-233a24.2

Sequence 1:NP_001162994.1 Gene:CG42556 FlyBaseID:FBgn0260758 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001139056.1 Gene:si:ch211-233a24.2 ZFINID:ZDB-GENE-090313-98 Length:4922 Species:Danio rerio

Alignment Length:279 Identity:58/280 (21%)
Similarity:99/280 (35%) Gaps:68/280 (24%)


  Fly     1 MQALRTVIQGLSTRHGQIISHIRRSSGSSSFPELAFFDDLDDMEPEDEEGVMNHQYPILHSRHSD 65
            :.||.|:.:||.....|.:..|..:.|   |..:.....|.  :|:::|.|...|.|.|      
Zfish  2081 LPALVTLRKGLVALARQWMKFIVVTQG---FKAVGLPQQLP--KPKEQEPVEPEQTPGL------ 2134

  Fly    66 LFYMPNCVGPAYQGLISSLDQPYTTDCYMADEQTLVKENDSIHDTILESLVAPTEMCVVACPKLL 130
                 :| |.|.|...|:....:..|.....|.|::.|.       :.|..|||..   :.|...
Zfish  2135 -----DC-GGALQSDTSADGAEFEFDAGTVSEHTMLLEG-------VCSRPAPTGN---SAPVTG 2183

  Fly   131 LTYMRRLFQ--------------HPYARFG---------SSMNFSMIGLRFKDKDANKALTSFVH 172
            :..||:|.:              |||....         |..:.|..||:.......::|.|::.
Zfish  2184 VEIMRKLSKSHTHSESALRIKGSHPYQSLSYTSGDTAADSPAHVSRTGLQCNHSPRKESLLSYLT 2248

  Fly   173 FASYNSREIMD------NGYWADFINPLTGRAYYRAAHCIRKQGL-EAQLLGRGLNLTFANGCT- 229
            .:.::...:::      |...|...:.||     |..:.:....| |..||....:::|.|..: 
Zfish  2249 GSIHSLHNLLEATPHRANEQTATKSSSLT-----RTGNSVGADVLTEHPLLSEPFSVSFYNWMSN 2308

  Fly   230 IIGEEQSDQLTGFIFTDTP 248
            .:|..     ||....|:|
Zfish  2309 AVGNR-----TGGNVQDSP 2322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42556NP_001162994.1 DUF2246 <117..248 CDD:287231 31/162 (19%)
si:ch211-233a24.2NP_001139056.1 FSA_C 4295..4903 CDD:287455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.