DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42556 and mmadhc

Sequence 1:NP_001162994.1 Gene:CG42556 FlyBaseID:FBgn0260758 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001016731.1 Gene:mmadhc XenbaseID:XB-GENE-973161 Length:297 Species:Xenopus tropicalis

Alignment Length:299 Identity:58/300 (19%)
Similarity:99/300 (33%) Gaps:103/300 (34%)


  Fly    20 SHIRRSSGSSSF---------------------PELAFFDD-LDDMEPEDEEGVMNHQYPILHSR 62
            |.|||.||:.:|                     |...:.|: :....|:|:.             
 Frog    20 SLIRRVSGTRAFSTAGSSGSDEPYIAATPPDILPRTVWPDETMGPFGPQDQR------------- 71

  Fly    63 HSDLFYMPNCVGPAYQGLISSLD------------------QP----------YTTDCYMADEQT 99
                |.:|..||  :...::.:|                  ||          :.|: :...|.:
 Frog    72 ----FQLPGNVG--FDAHVNGIDIKRRIEVNRNLPDLLTEPQPSERHEFVMAQFVTE-FQGSEVS 129

  Fly   100 LVKENDSIHDTILESLVAPTEMCVVACPKLLLTYMRRLFQHPYARFGSSM---------NFSMIG 155
            |..:..:..::..|:  |..|..:.:||.||......:|  |.....:.|         |...|.
 Frog   130 LEPQELNTMESYFEN--AKVECAMQSCPDLLKKDFASMF--PEIPSNNLMVLTVTQRTHNDMTIW 190

  Fly   156 LRFKDKDANKALTSFVHFASYNSREIMDNGYWADFINPLTGRAY---------YRAAHCIRKQGL 211
            .:..:.:....:..|::.|......:...|||||||:||:|.||         :......|..|.
 Frog   191 SQEVENEREMLIEKFMNGAKEICYALRTEGYWADFIDPLSGLAYFGPYTNNTLFETDERYRHLGF 255

  Fly   212 EAQLLGRGLNLTFANGCTIIGEE--QSDQLTGFIFTDTP 248
            :.:.||         .|.:|...  .:..:.|.|||:.|
 Frog   256 KVEDLG---------CCKVIRHNVWGTHVVVGSIFTNAP 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42556NP_001162994.1 DUF2246 <117..248 CDD:287231 35/151 (23%)
mmadhcNP_001016731.1 DUF2246 24..294 CDD:287231 55/296 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1363001at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.