DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42556 and mmadhca

DIOPT Version :9

Sequence 1:NP_001162994.1 Gene:CG42556 / 8674031 FlyBaseID:FBgn0260758 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001002453.1 Gene:mmadhca / 436726 ZFINID:ZDB-GENE-040718-152 Length:291 Species:Danio rerio


Alignment Length:285 Identity:53/285 - (18%)
Similarity:98/285 - (34%) Gaps:99/285 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SSGS----------SSFPELAFFDD-LDDMEPEDEEGVMNHQYPILHSRHSDLFYMPNCVGPAYQ 78
            ||||          ::.|...:.|: :....|:|:.                 |.:|..||    
Zfish    36 SSGSDEPYIAVPSQNTGPRTVWPDEAMGPFGPQDQR-----------------FQLPGNVG---- 79

  Fly    79 GLISSLDQPYTTDCYMADEQTLVKENDSIHDTILESLVAPT------------------------ 119
                       .||::  :.|.::.:..:|.|:.:.|..|:                        
Zfish    80 -----------FDCHL--KGTELQMSGPVHKTVPDVLSVPSSTERHEFILAQFINEFQGKEASVA 131

  Fly   120 ----------------EMCVVACPKLLLTYMRRLFQHPYARFGSSMNFSMIGLRFKD----KDAN 164
                            |..:.:||:||...:...|  |..   .:...:::.:..|:    :|..
Zfish   132 VQRVSKAELYFSQSDVECSMRSCPELLKKELELFF--PVL---PTSPITVVTVMQKNQELTRDQE 191

  Fly   165 KALTSFVHFASYNSREIMDNGYWADFINPLTGRAYY--RAAHCIRKQGLEAQLLGRGLNLTFANG 227
            :.|.:||..|......:...||||||||||:|:|::  :....|.:|.::..   .|.::.....
Zfish   192 ELLDNFVSGAKEICFTLWRGGYWADFINPLSGKAFFAVQTPDSILQQDVQHH---AGFHIEDLAS 253

  Fly   228 CTIIGEEQSDQLTGFIFTDTPCKVL 252
            ||:|...........:.|:.|...|
Zfish   254 CTVIRHVLKGTFVLTLITNAPSNSL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42556NP_001162994.1 DUF2246 <117..248 CDD:287231 33/176 (19%)
mmadhcaNP_001002453.1 MMADHC 24..284 CDD:313456 53/285 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1363001at2759
OrthoFinder 1 1.000 - - FOG0006544
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105788
Panther 1 1.100 - - O PTHR13192
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.