DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42556 and mmadhc

Sequence 1:NP_001162994.1 Gene:CG42556 FlyBaseID:FBgn0260758 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_991157.2 Gene:mmadhc ZFINID:ZDB-GENE-040704-50 Length:297 Species:Danio rerio

Alignment Length:302 Identity:63/303 (21%)
Similarity:104/303 (34%) Gaps:86/303 (28%)


  Fly     4 LRTVIQGLSTRHGQIISHIRRSSGSSSFPELAFFDDLDDME-----PEDEEGVMNHQYPILHSRH 63
            |.|.:.||.....:::. .|..||:|...|........|:.     |::..|....|        
Zfish    11 LVTYLPGLHVLVHRVVG-ARSFSGASGSDEPHLNTSTPDIAPRTVWPDESMGPFGPQ-------- 66

  Fly    64 SDLFYMPNCVGPAYQGLISSLDQPYTTDCY--MADEQTLVKENDSIHDTILESLV---------- 116
            ...|.:|..||  :...:.|..:..||..:  |.|..| .:.|:..||.||...:          
Zfish    67 DKRFQLPGNVG--FDCHLESPVEQRTTSVHSVMPDVLT-AQSNNQRHDFILAQFINELHEDDKTS 128

  Fly   117 --------------APTEMCVVACPKLLLTYMRRLFQHPYARFGSS-MNFSMIGLRFK------- 159
                          :..|..:.:||:||    :|.|:..:....|: |....:..|.:       
Zfish   129 TAQNMDKAEQFFDHSSVECAIQSCPELL----KRDFESMFPEAPSTGMMVVTVTQRTQNDMTAWT 189

  Fly   160 ---DKDANKALTSFVHFASYNSREIMDNGYWADFINPLTGRAYY-------------RAAHCIRK 208
               |::..:.|..|:..|......:.:.|:|||||:|.:|.||:             |..|.   
Zfish   190 EQVDQEREELLAKFIEGAKEICHALRNEGFWADFIDPSSGLAYFGSYTNNTLFETDDRYRHL--- 251

  Fly   209 QGLEAQLLGRGLNLTFANGCTIIGEEQ--SDQLTGFIFTDTP 248
             |.:.:.||         .|.:|....  :....|.:||..|
Zfish   252 -GFQIEDLG---------CCKVIRHVMWGTHAFVGTLFTSAP 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42556NP_001162994.1 DUF2246 <117..248 CDD:287231 34/157 (22%)
mmadhcNP_991157.2 DUF2246 24..293 CDD:287231 59/290 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1363001at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13192
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.