DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42556 and Mmadhc

Sequence 1:NP_001162994.1 Gene:CG42556 FlyBaseID:FBgn0260758 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_006234220.1 Gene:Mmadhc RGDID:1303272 Length:370 Species:Rattus norvegicus

Alignment Length:172 Identity:42/173 (24%)
Similarity:67/173 (39%) Gaps:47/173 (27%)


  Fly    67 FYMPNCVG--------------PAYQGLISSLDQPYTTDCY---MA-------DEQTLVKENDSI 107
            |.:|..:|              .|::.|...|.:|.:|:.:   ||       |....|::..|.
  Rat   146 FQLPGNIGFDCHLNGTASQKKSQAHKTLPDVLAEPLSTERHEFVMAQYVNEFQDSNAPVEQEISS 210

  Fly   108 HDTILESLVAPTEMCVVACPKLLLTYMRRLFQHPYARFGSSMNFSMIGLRFKDK----------- 161
            .:|..||  |..|..:..||:||    ||.|:   :.|....|..::.|....|           
  Rat   211 AETYFES--ARVECAIQTCPELL----RRDFE---SLFPEVANSKLMILTVTQKTEHDMTVWSEE 266

  Fly   162 ---DANKALTSFVHFASYNSREIMDNGYWADFINPLTGRAYY 200
               :....|..|::.|......:...|||||||:|.:|.|::
  Rat   267 VEVEREALLEKFINGAKEICYALRAEGYWADFIDPSSGLAFF 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42556NP_001162994.1 DUF2246 <117..248 CDD:287231 26/99 (26%)
MmadhcXP_006234220.1 DUF2246 98..367 CDD:287231 42/173 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1363001at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13192
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.