DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42556 and tweek

Sequence 1:NP_001162994.1 Gene:CG42556 FlyBaseID:FBgn0260758 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001286002.1 Gene:tweek FlyBaseID:FBgn0261671 Length:5150 Species:Drosophila melanogaster

Alignment Length:211 Identity:46/212 (22%)
Similarity:75/212 (35%) Gaps:58/212 (27%)


  Fly    36 FFDDLDDME-PEDEEGVMNHQYPILHSRHSDLFYMPNCVGPAYQGLISSLDQPYTTDCYMADEQT 99
            |.:|...|| |:.:||..:.:...:. |..|...:|..|   :...|.|..:.:..:..||::..
  Fly  3718 FEEDETQMESPDSDEGDQSCRDTFVR-RRGDFDNLPAFV---FDPTIDSKKRSFMMEKEMAEQLK 3778

  Fly   100 LVKENDSI---HDTI------LESLVAPTEMCVVAC--------------PKL---LLTYMRRLF 138
            ::.:..::   |:|:      |:.|.|       .|              |.|   |.||.|   
  Fly  3779 IINDLRTLGASHNTVAHEERRLQELQA-------ICYKYFRRDMIQKWKRPSLRRSLKTYGR--- 3833

  Fly   139 QHPYARFGSSM----------NFSMIGLRFKDKDANKALTSF------VHFASYNSREIMDNGYW 187
            .|.|...|||:          |.|..|.|.....:|..::|.      .|..|.:.:.....|..
  Fly  3834 SHSYIGSGSSVSGVGVPQTLDNVSYTGRRLDTIASNDEISSLQSTPASCHSRSASLKHTTGGGVI 3898

  Fly   188 ADFINPLTGRAYYRAA 203
            ...:|.| ||..:..|
  Fly  3899 GGGVNAL-GRVTFTEA 3913

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42556NP_001162994.1 DUF2246 <117..248 CDD:287231 27/121 (22%)
tweekNP_001286002.1 FSA_C 4415..5113 CDD:287455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3596
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.