DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42556 and CG12118

Sequence 1:NP_001162994.1 Gene:CG42556 FlyBaseID:FBgn0260758 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_572537.1 Gene:CG12118 FlyBaseID:FBgn0030101 Length:284 Species:Drosophila melanogaster

Alignment Length:229 Identity:58/230 (25%)
Similarity:92/230 (40%) Gaps:52/230 (23%)


  Fly    39 DLDDMEPEDE----EGVMNHQYPILHSRHSDLFYMPNCVGPAYQGLISSLDQPYTTDCYMADEQT 99
            ||||   :||    |...|.:   |.:...:.||:||.:|||:||                    
  Fly    70 DLDD---DDELNSLESEPNWE---LTAERGNRFYLPNGIGPAWQG-------------------- 108

  Fly   100 LVKENDSIHDTILESL-------------VAPTEMCVVACPKLLLTYMRRLFQHPYARFGSSMNF 151
                 ||....:||.|             .:..|.....||.|:...:..:|..|... ...:|.
  Fly   109 -----DSTTVGLLEPLGHLVNFHKGPNTDKSRLEFTCCKCPLLIRVPLLEIFPVPVVA-QQCINI 167

  Fly   152 SMIGLRFKDKDANKALTSFVHFASYNSREIMDNGYWADFINPLTGRAYYRAAHCIRKQGLEAQLL 216
            :|:.|. .:.|.......||..|......::..||||||:||.:||.::..........|:::..
  Fly   168 TMLVLS-HEGDIEMGAAKFVLAAREMCDRLLSYGYWADFMNPFSGRPFFLPREGANLYRLDSRFR 231

  Fly   217 GRGLNLTFANGCTIIGEEQSD--QLTGFIFTDTP 248
            |..:.|:..|.||:|..|::|  :.:|.|::..|
  Fly   232 GLNMRLSEQNRCTVISAEKNDSTRFSGTIYSTAP 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42556NP_001162994.1 DUF2246 <117..248 CDD:287231 34/133 (26%)
CG12118NP_572537.1 DUF2246 22..275 CDD:287231 58/230 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140903737
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1363001at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13192
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.