DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42556 and MMADHC

DIOPT Version :9

Sequence 1:NP_001162994.1 Gene:CG42556 / 8674031 FlyBaseID:FBgn0260758 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_056517.1 Gene:MMADHC / 27249 HGNCID:25221 Length:296 Species:Homo sapiens


Alignment Length:158 Identity:40/158 - (25%)
Similarity:60/158 - (37%) Gaps:43/158 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PILHSRHSDLFYMPNCVGPAYQGLISSLDQPYTTDCYMADEQTLVKENDSIHDTILESLVAPTEM 121
            |:...||.  |.|...|. .:||    .|.|             |::..:..:|..||  |..|.
Human   106 PLSSERHE--FVMAQYVN-EFQG----NDAP-------------VEQEINSAETYFES--ARVEC 148

  Fly   122 CVVACPKLLLTYMRRLFQHPYARFGSSMNFSMIGLRFKDKDANK--------------ALTSFVH 172
            .:..||:||    |:.|:   :.|....|..::.|....|..|.              .|..|::
Human   149 AIQTCPELL----RKDFE---SLFPEVANGKLMILTVTQKTKNDMTVWSEEVEIEREVLLEKFIN 206

  Fly   173 FASYNSREIMDNGYWADFINPLTGRAYY 200
            .|......:...|||||||:|.:|.|::
Human   207 GAKEICYALRAEGYWADFIDPSSGLAFF 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42556NP_001162994.1 DUF2246 <117..248 CDD:287231 26/98 (27%)
MMADHCNP_056517.1 MMADHC 24..293 CDD:402023 40/158 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1363001at2759
OrthoFinder 1 1.000 - - FOG0006544
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105788
Panther 1 1.100 - - LDO PTHR13192
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.