DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42556 and Bltp1

DIOPT Version :10

Sequence 1:NP_001162994.1 Gene:CG42556 / 8674031 FlyBaseID:FBgn0260758 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_006535509.1 Gene:Bltp1 / 229227 MGIID:2444631 Length:5094 Species:Mus musculus


Alignment Length:123 Identity:24/123 - (19%)
Similarity:51/123 - (41%) Gaps:43/123 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 KENDSI-------------HDTILESLVAPTEMCVVACPKLL-LTY-------------MRRLFQ 139
            ::||||             |::.:..|:..|   :::|..:: |||             :.||::
Mouse     4 RKNDSIVPSITQLEDFLTEHNSNVVWLLVAT---ILSCGWIIYLTYYNSRNVGLILTLVLNRLYK 65

  Fly   140 HPYARFGSSMNFSMIGLRFKDKDANKALTSFVHFASYNSREIMDNGY----WADFINP 193
            |.|...| |.:||::        :.|.:...:::.:.:....:.:|:    |....||
Mouse    66 HGYIHIG-SFSFSVL--------SGKVMVREIYYITEDMSIRIQDGFIIFRWWKMYNP 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42556NP_001162994.1 MMADHC <96..248 CDD:431154 24/123 (20%)
Bltp1XP_006535509.1 Kiaa1109_N 47..1049 CDD:466562 13/77 (17%)
FSA_C 4471..5076 CDD:463105
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.