DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42556 and 4932438A13Rik

DIOPT Version :9

Sequence 1:NP_001162994.1 Gene:CG42556 / 8674031 FlyBaseID:FBgn0260758 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_006535509.1 Gene:4932438A13Rik / 229227 MGIID:2444631 Length:5094 Species:Mus musculus


Alignment Length:123 Identity:24/123 - (19%)
Similarity:51/123 - (41%) Gaps:43/123 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 KENDSI-------------HDTILESLVAPTEMCVVACPKLL-LTY-------------MRRLFQ 139
            ::||||             |::.:..|:..|   :::|..:: |||             :.||::
Mouse     4 RKNDSIVPSITQLEDFLTEHNSNVVWLLVAT---ILSCGWIIYLTYYNSRNVGLILTLVLNRLYK 65

  Fly   140 HPYARFGSSMNFSMIGLRFKDKDANKALTSFVHFASYNSREIMDNGY----WADFINP 193
            |.|...| |.:||::        :.|.:...:::.:.:....:.:|:    |....||
Mouse    66 HGYIHIG-SFSFSVL--------SGKVMVREIYYITEDMSIRIQDGFIIFRWWKMYNP 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42556NP_001162994.1 DUF2246 <117..248 CDD:287231 18/95 (19%)
4932438A13RikXP_006535509.1 FSA_C 4469..5076 CDD:313663
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.