DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42556 and Y76A2B.5

DIOPT Version :9

Sequence 1:NP_001162994.1 Gene:CG42556 / 8674031 FlyBaseID:FBgn0260758 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_499801.1 Gene:Y76A2B.5 / 176786 WormBaseID:WBGene00013577 Length:283 Species:Caenorhabditis elegans


Alignment Length:229 Identity:53/229 - (23%)
Similarity:83/229 - (36%) Gaps:61/229 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PNCVGPAYQGLISSLDQPYT---------TDCYMAD-EQTLVK-------ENDSIH-----DTIL 112
            ||.....:||.:|...:|.:         .:..|.| |..|:.       |.|..|     :..:
 Worm    47 PNDSQYPFQGDVSFAHKPLSIRQQVENSKIERVMDDTEHNLINLLSNTNIEVDRTHLAQLKEEAM 111

  Fly   113 ESLVA-----PTEMCVVACPKLLLTYMRRLFQHPYARFGSSMNFSMIGLRFK------------D 160
            |.:.|     ..|:..:..||||...|:.||  |........|.::..|..|            :
 Worm   112 EEIQANAADVEIELSAIEAPKLLKKEMKYLF--PQMETQKMNNVTVFNLTQKSEFDMKAWSEAME 174

  Fly   161 KDANKALTSFVHFASYNSREIMDNGYWADFINPLTGRAY---------YRAAHCIRKQGLEAQLL 216
            ::..|...||:..|:.....:...|||||||:|.:||.|         :......::.|.:.:.|
 Worm   175 EEREKLTASFIMSANAICSTLHRFGYWADFIDPSSGRPYMGDYTNHTLFETNDAYKQMGFKIEDL 239

  Fly   217 GRGLNLTFANGCTIIGEE--QSDQLTGFIFTDTP 248
            |         .|.::...  .|:...|.||||.|
 Worm   240 G---------CCKVLQHACWGSNAFVGTIFTDAP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42556NP_001162994.1 DUF2246 <117..248 CDD:287231 38/158 (24%)
Y76A2B.5NP_499801.1 DUF2246 5..274 CDD:287231 53/229 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1363001at2759
OrthoFinder 1 1.000 - - FOG0006544
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105788
Panther 1 1.100 - - LDO PTHR13192
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.