| Sequence 1: | NP_001162994.1 | Gene: | CG42556 / 8674031 | FlyBaseID: | FBgn0260758 | Length: | 257 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001300467.1 | Gene: | lpd-3 / 171926 | WormBaseID: | WBGene00003060 | Length: | 4022 | Species: | Caenorhabditis elegans |
| Alignment Length: | 262 | Identity: | 44/262 - (16%) |
|---|---|---|---|
| Similarity: | 67/262 - (25%) | Gaps: | 124/262 - (47%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 27 GSSSFPELAFFDDLDDM------------------------EPEDEEGVMNHQYPILHSRHSDLF 67
Fly 68 YMPNCVGPAYQGLISSLDQPYTTDCYMADEQTLVKENDSIHDTILESLVAPTEMCVVACPKLLLT 132
Fly 133 YMRRLFQHPYARFGSSMNFSMIGLRFKD----------------------------------KDA 163
Fly 164 NKALTSFVHFAS---------YNS-------REIMDNGYWAD----FINPLTGRAYYR----AAH 204
Fly 205 CI 206 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42556 | NP_001162994.1 | DUF2246 | <117..248 | CDD:287231 | 26/148 (18%) |
| lpd-3 | NP_001300467.1 | FSA_C | 3367..>3864 | CDD:313663 | |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3596 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||