DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc76C and Npr1

DIOPT Version :8

Sequence 1:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_036745.1 Gene:Npr1 / 24603 RGDID:3195 Length:1057 Species:Rattus norvegicus

Alignment Length:1139 Identity:410/1140 (36%)
Similarity:600/1140 (53%) Gaps:176/1140 (15%)


  Fly     9 LLLLSVAVRDCSNHRTVLTVGYLTALTGDLKTRQGLAISGALTMALDEVNKDPNLLPN------- 66
            ||||...:.....|.:.|||..:..||..........:..|:.:||..|...|:|||.       
  Rat    14 LLLLPPLLLLRGGHASDLTVAVVLPLTNTSYPWSWARVGPAVELALARVKARPDLLPGWTVRMVL 78

  Fly    67 -----------------VYLDLRWNDTKGDTVLATKAITEMICDGIATIFGPEGPCYVEAIVSQS 114
                             ..:||:|..:.                  |...|| |..|..|.|.:.
  Rat    79 GSSENAAGVCSDTAAPLAAVDLKWEHSP------------------AVFLGP-GCVYSAAPVGRF 124

  Fly   115 R---NIPMISYKCA--------EYRASAIPTFARTEPPDTQVVKSLLALLRYYAW-NKFSILYED 167
            .   .:|:::....        ||   |:.|  ||.|...::...:.||.|...| ::..:||.|
  Rat   125 TAHWRVPLLTAGAPALGIGVKDEY---ALTT--RTGPSHVKLGDFVTALHRRLGWEHQALVLYAD 184

  Fly   168 -------VWSPVADLLKDQATKRNMTINHKQSFIDNRVKCCEQMLDCCRSGYWYQLVQNTMNRTR 225
                   .:..|..|......:.|:|:|| |.|::.            ...::.:|::....:.|
  Rat   185 RLGDDRPCFFIVEGLYMRVRERLNITVNH-QEFVEG------------DPDHYPKLLRAVRRKGR 236

  Fly   226 IYVFLGAANSLVDFMSSMETAGLFARGEYMVIFVDMMVYSEREA-----EKYLRRVDQITFMSNC 285
            :.....:.::..:.|.....|||... :|:...:|:...|.:.|     :|...|.|     ...
  Rat   237 VIYICSSPDAFRNLMLLALNAGLTGE-DYVFFHLDVFGQSLKSAQGLVPQKPWERGD-----GQD 295

  Fly   286 HSTENFNQMARSLLVVASTPPTKDYIQFTKQVQKYSSKPPFNLEIPRLFVESNFSKFISIYAAYL 350
            .|.....|.|:  ::....|...:|::|.||::..:.| .||..     ||....   :|..|..
  Rat   296 RSARQAFQAAK--IITYKEPDNPEYLEFLKQLKLLADK-KFNFT-----VEDGLK---NIIPASF 349

  Fly   351 YDSVKLYAWAVDKMLREETRVLTDDVIFEVASNGTRVIDTIIKNRTYMSITGSKIKIDQYGDSEG 415
            :|.:.||..||.:.|.:...|          ::|..:... :.||::..:|| .:|||:.||.:.
  Rat   350 HDGLLLYVQAVTETLAQGGTV----------TDGENITQR-MWNRSFQGVTG-YLKIDRNGDRDT 402

  Fly   416 NFSVLAYKPHKWNNSNNMPCNYH-----MVPVAYFHQGEEHPEYKLINGSIDWPSGGEKPADEPM 475
            :||:....|.  ..:..:..||:     ::.|:      ||..|        ||. |..|.|.|.
  Rat   403 DFSLWDMDPE--TGAFRVVLNYNGTSQELMAVS------EHKLY--------WPL-GYPPPDVPK 450

  Fly   476 CGFANE--LCKKDDTHY-TSTVAAVVLGVLLFCSGVITMSIYRKWKIELEIEGLLWKI-----DP 532
            |||.||  .|.:|  |: |..|.|:|..:.|....:::..||||.::|.|:...||::     .|
  Rat   451 CGFDNEDPACNQD--HFSTLEVLALVGSLSLISFLIVSFFIYRKMQLEKELVSELWRVRWEDLQP 513

  Fly   533 NEIKGYSGNEIVSSPSKVSLMS-AQSYGSRWTN----QFVTSTGRLRGAVVRIKELKFPRKR-DI 591
            :.::    ..:.|:.|:::|.. ..:|||..|.    |....|...:|.:|.:|.:.  ||| ::
  Rat   514 SSLE----RHLRSAGSRLTLSGRGSNYGSLLTTEGQFQVFAKTAYYKGNLVAVKRVN--RKRIEL 572

  Fly   592 SREIMKEMRLLRELRHDNINSFIGASVEPTRILLVTDYCAKGSLYDIIENEDIKLDDLFIASLIH 656
            :|:::.|::.:|:::::::..|:||..:|..|.::|:||.:|||.||:|||.|.||.:|..||.:
  Rat   573 TRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTN 637

  Fly   657 DLIKGMIYIHNSQLVYHGNLKSSNCVVTSRWMLQVTDFGLHELRQCAENESIGEHQHYRNQLWRA 721
            |::|||:::||..:..|||||||||||..|::|::||:||...|   :.|....|..:..:||.|
  Rat   638 DIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDYGLESFR---DPEPEQGHTLFAKKLWTA 699

  Fly   722 PELLR---NHIHGSQKGDVYAFAIIMYEIFSRKGPF--GQINFEPKEIVDYVKKLPLKGED-PFR 780
            |||||   ....|||.||||:|.||:.||..|.|.|  ..::..||||::.|    .:||. |||
  Rat   700 PELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVEGLDLSPKEIIERV----TRGEQPPFR 760

  Fly   781 PEVESIIEAESCPDYVLACIRDCWAEDPEERPEFSVIRNRLKKMRGGKTKNIMDQMMEMMEKYAN 845
            |.    ::.:|..:.:...::.||||||:|||.|..||..|:|.....:.||:|.::..||:|||
  Rat   761 PS----MDLQSHLEELGQLMQRCWAEDPQERPPFQQIRLALRKFNKENSSNILDNLLSRMEQYAN 821

  Fly   846 NLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSA 910
            |||::|.|||:...|||.|.|.||:::||.||||:|..|:.|:..::|.|||||||||||||:||
  Rat   822 NLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSA 886

  Fly   911 ESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALELLHA 975
            ||||:|||..||||||.||.:|..:|||||||||||||||||||::||..||.|:|.|||.||.|
  Rat   887 ESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDA 951

  Fly   976 VKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISNKC 1040
            |:..||.|||.|.|:||||:|||||.||||||.|||||||||||||||||||||||||||:|::.
  Rat   952 VRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSET 1016

  Fly  1041 KLALDKLGGGYITEKRGLVNMKGKGDVVTWWLTG 1074
            |..|::. .|:..|.||.|.|||||.|.|:||.|
  Rat  1017 KAVLEEF-DGFELELRGDVEMKGKGKVRTYWLLG 1049

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365 97/472 (21%)
ANF_receptor 48..412 CDD:279440 85/412 (21%)
PK_GC-A_B 543..827 CDD:270944 115/296 (39%)
HNOBA <835..881 CDD:285003 25/46 (54%)
CYCc 860..1052 CDD:214485 133/192 (69%)
Guanylate_cyc 887..1074 CDD:278633 131/187 (70%)
Npr1NP_036745.1 PBP1_NPR_A 32..439 CDD:107380 99/489 (20%)
ANF_receptor 50..410 CDD:279440 88/426 (21%)
PK_GC-A_B 530..803 CDD:270944 112/286 (39%)
TyrKc 543..797 CDD:197581 106/267 (40%)
HNOBA <812..857 CDD:285003 25/45 (56%)
CYCc 836..1025 CDD:214485 132/190 (69%)
Guanylate_cyc 863..1049 CDD:278633 131/187 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D123766at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11920
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.