DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42495 and Tmem42

Sequence 1:NP_001163464.1 Gene:CG42495 FlyBaseID:FBgn0260027 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001178815.1 Gene:Tmem42 RGDID:1307118 Length:157 Species:Rattus norvegicus

Alignment Length:114 Identity:33/115 (29%)
Similarity:51/115 (44%) Gaps:17/115 (15%)


  Fly    11 LVAGSFAAAGSFFGKLPSHLSAQKLLNTSQINEDFSYLEIALLQLLPLVLMVTCNVCNLRFFLKA 75
            :.||:|.|..:         :|.||...||:|       |.|. :|.::.|.:.|.....||.:.
  Rat    44 MCAGAFGALAA---------AAAKLAFGSQVN-------IGLC-VLGIIAMASTNSLMWTFFSRG 91

  Fly    76 LQMTEQTLTCVVLTAASNYVLSFVLGALVYREPLTVLSGIGITLILAGL 124
            |..:..:....|....||.:.|.:||.::|.|...:|...|:.|||.||
  Rat    92 LSFSMSSAIASVTVTFSNILCSAILGYVLYGECQEILWWGGVFLILCGL 140



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C161623653
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005579
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132465
Panther 1 1.100 LDO PTHR31965
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.