DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42577 and CG42578

DIOPT Version :10

Sequence 1:NP_001162806.1 Gene:CG42577 / 8673999 FlyBaseID:FBgn0260867 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001162807.1 Gene:CG42578 / 8674106 FlyBaseID:FBgn0260868 Length:92 Species:Drosophila melanogaster


Alignment Length:92 Identity:84/92 - (91%)
Similarity:85/92 - (92%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPEKSNAKANPIGSNEVLMTEDPEQSSGSKEGSQSSEAEEEHISEAFQRLEEKLNDMERRIAHAR 65
            |.|||||||.|.|:||.||||||||.|||||||||||||||||||||.|||||||||||||||||
  Fly     1 MEEKSNAKAKPTGNNEFLMTEDPEQPSGSKEGSQSSEAEEEHISEAFHRLEEKLNDMERRIAHAR 65

  Fly    66 KVKRRLFVRLLCLILDLLQAKLYLQYT 92
            |||||||||||||||||||||||||.|
  Fly    66 KVKRRLFVRLLCLILDLLQAKLYLQNT 92

Return to query results.
Submit another query.