DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42577 and CG42579

DIOPT Version :8

Sequence 1:NP_001162806.1 Gene:CG42577 / 8673999 FlyBaseID:FBgn0260867 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001162810.1 Gene:CG42579 / 8674025 FlyBaseID:FBgn0260869 Length:99 Species:Drosophila melanogaster

Alignment Length:99 Identity:48/100 (48%)
Similarity:61/100 (61%) Gaps:17/100 (17%)


  Fly     1 MPEKSNAKANPIGSNEVLMTEDPEQSSGSKEGSQSSEAEEEHISEA---------------FQRL 50
            |.|:|:|||||||:||.||||||||.||||||||||.|... .:||               |||:
  Fly     1 MEEESSAKANPIGNNESLMTEDPEQPSGSKEGSQSSGASSS-TTEASLNTINVTTQKKRSQFQRI 64

  Fly    51 EEKLNDMERRIAHARKVKRRLFVRLLCLILDLLQ 84
            .|||.|:||::....:: ..||:.||..|.:.|:
  Fly    65 YEKLEDLERQMDQYEQM-NELFIHLLATIQEELE 97



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141724749
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.