DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: EIF3I and eIF3i

Sequence 1:NP_003748.1 Gene:EIF3I HGNCID:3272 Length:325 Species:Homo sapiens
Sequence 2:NP_523478.1 Gene:eIF3i FlyBaseID:FBgn0015834 Length:326 Species:Drosophila melanogaster

Alignment Length:326 Identity:198/327 (61%)
Similarity:252/327 (77%) Gaps:2/327 (1%)


Human     1 MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTK 65
            |:|::|||||||||||||||||||||:.:||...|||||:||||||||.||.|||||:|.||:::
  Fly     1 MRPLMLQGHERSITQIKYNREGDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVDWESR 65

Human    66 HVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRD- 129
            .::||:.|.:.::||.|.|..:|.:.|.|:|||..|.|.||...:||||.||..|.:...|:|: 
  Fly    66 KLITGAGDMTAKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQSCELFLIDVRNA 130

Human   130 PSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNV-KEHSRQIND 193
            .|.:...||.::||..:|||||.:||||.|.||.||::|.:..:..:.|:.:|:. .:||..|||
  Fly   131 DSSLSEQEPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQKVVDSGTDHSAGIND 195

Human   194 IQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTT 258
            :|||:|.|||||||||.|||||||.:|...||::|||||||||:||..|||||||||:||:||||
  Fly   196 MQLSKDGTMFVTASKDTTAKLFDSESLMCLKTYKTERPVNSAAISPIMDHVVLGGGQDAMEVTTT 260

Human   259 STRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEF 323
            ||:.|||::|||||.:||||.|:|||||||||:|||||||||:||||||:||:..||..|||..|
  Fly   261 STKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYFENIF 325

Human   324 E 324
            |
  Fly   326 E 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
EIF3INP_003748.1 WD 1 1..39 29/38 (76%)
WD40 6..311 CDD:356469 189/307 (62%)
WD40 repeat 14..50 CDD:293791 28/36 (78%)
WD 2 43..81 21/38 (55%)
WD40 repeat 55..91 CDD:293791 14/36 (39%)
WD 3 87..127 18/40 (45%)
WD 4 135..175 19/40 (48%)
WD40 repeat 150..185 CDD:293791 14/36 (39%)
WD 5 180..217 25/38 (66%)
WD40 repeat 191..224 CDD:293791 24/33 (73%)
WD 6 221..267 33/46 (72%)
WD40 repeat 232..272 CDD:293791 31/40 (78%)
WD 7 275..316 33/41 (80%)
WD40 repeat 288..311 CDD:293791 20/23 (87%)
eIF3iNP_523478.1 WD40 6..313 CDD:295369 189/307 (62%)
WD40 <9..313 CDD:225201 186/304 (61%)
WD40 repeat 13..50 CDD:293791 29/37 (78%)
WD40 repeat 56..91 CDD:293791 13/35 (37%)
WD40 repeat 96..142 CDD:293791 19/46 (41%)
WD40 repeat 151..186 CDD:293791 14/35 (40%)
WD40 repeat 193..228 CDD:293791 26/35 (74%)
WD40 repeat 234..284 CDD:293791 37/50 (74%)
WD40 repeat 290..313 CDD:293791 20/23 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C153651691
eggNOG 1 0.900 E1_KOG0643
Hieranoid 1 1.000
Homologene 1 1.000 H2786
Inparanoid 1 1.050 416 1.000 Inparanoid score I1807
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D458807at33208
OrthoFinder 1 1.000 FOG0004210
OrthoInspector 1 1.000 T1072445
orthoMCL 1 0.900 OOG5_127718
Panther 1 1.100 LDO PTHR19877
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R384
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.