DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNF1 and CG33298

Sequence 1:NP_011093.3 Gene:DNF1 SGDID:S000000968 Length:1571 Species:Saccharomyces cerevisiae
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1448 Identity:426/1449 (29%)
Similarity:650/1449 (45%) Gaps:343/1449 (24%)


Yeast   133 RSKTLKWARKNIPNP-FEDFTKDDIDPGAINRAQELRTVYYNMPLPKDMIDEEGNPIMQYPRNKI 196
            ||:::...|:....| ::..|..:.:.|.....:..|||..|..:| ....:..:|..|:..|||
  Fly   192 RSESIYTLRRTEAPPWWKRLTLCNYNTGDKFEERSYRTVVPNHTVP-PKTPKRDHPNGQFVGNKI 255

Yeast   197 RTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLVVIVIITAIKDAIE 261
            ||||||.|:|:|||:|.|||..||:||:.:::|............::.:|::.::.:||:||..|
  Fly   256 RTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFE 320

Yeast   262 DSRRTVLDLEVNNTKTHILEGVENENVSTDNISLWRRFKKANSRLLFKFIQYCKEHLTEEGKKKR 326
            |.||...|..:|||...:.:| |.|           |:||..                       
  Fly   321 DRRRRASDKRINNTTCRVYDG-ETE-----------RYKKVK----------------------- 350

Yeast   327 MQRKRHELRVQKTVGTSGPRSSLDSIDSYRVSADYGRPSLDYDNLEQGAGEANIVDRSLPPRTDC 391
                                                                             
  Fly   351 ----------------------------------------------------------------- 350

Yeast   392 KFAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTI 456
                  |:.::|||||.:.||:.:||||:||.|||..|.||::|.:||||||||.|:.::....:
  Fly   351 ------WQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRREVVRGFEEM 409

Yeast   457 RT----SKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKW 517
            ::    ||.::|    :|::.|.:.||.:.|.:..   ..||  ..||:...:|||...|:||.:
  Fly   410 QSIFVPSKFVSR----VEADAPTTKLYRFHGALIH---PTGE--RVPISTECLLLRESRLKNTDY 465

Yeast   518 AMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGRSR 582
            ..|:|::.|.:||.|||:.....|:|::.:::|..|:...::|.|||.|..|...::.     |.
  Fly   466 IEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMWL-----SS 525

Yeast   583 FS-YEFGTIAGSAATNGFVS---FWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKL 643
            |: :....:..:..|....|   ||..:::.|.::|:|||:::|:.|..|...|:.:|.|::|:.
  Fly   526 FTHFPVPYLPPNKLTANMESMWIFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAET 590

Yeast   644 DYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDV 708
            :.....::.||:::|||:::||:|||||||:|.|.|::|.:||..|....:| |..:..:.|   
  Fly   591 NKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPPSE-LEKIYSKPG--- 651

Yeast   709 ETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFV----------------RDLKG 757
                  ..|......|.:..::..|:..:...|.....  :||:                ||:..
  Fly   652 ------APAPPLIPNDNLNSDMAQLTQGTYLTPHAQRI--QEFLVVLAICNTVIVGAAPHRDMMN 708

Yeast   758 ASG--EVQQ-------------------------------------------------RCCE--- 768
            |||  ||||                                                 |..|   
  Fly   709 ASGIIEVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRS 773

Yeast   769 -------HFMLAL-ALCH-------SVLVEANPDNP----------------------------- 789
                   :.:.|| |..|       |...|::|::.                             
  Fly   774 VTPSPPPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINS 838

Yeast   790 ---------------KKLDL------------------KAQSPDEAALVATARDVGFSFVGKTKK 821
                           |::.|                  :|:||||.|||..|.......:.::..
  Fly   839 KITSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPN 903

Yeast   822 GLIIE--MQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQ 884
            .:::.  |.|..:|:|||.:|.|:||||.||.:|:..|     ....:|..|||||.|...|...
  Fly   904 QILVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQIG-----SQEIVLYTKGADSSIMPVLVPC 963

Yeast   885 SGSNSEAIL-EKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVA 948
            |.::.|.|| |:|...|::||.||||.|.:|:|.|:.::|..|..::.....||.|||..|....
  Fly   964 SHNSPEGILREQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSF 1028

Yeast   949 DSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELL 1013
            ..:|..|.|||.|.||||||||||:.|..|..|||.:|||||||.||||||.:|..|...:|||:
  Fly  1029 AKLESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELI 1093

Yeast  1014 VIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVIDGDALK 1078
            .:.....|..|          ..::.||.:..|    ::............|...|:|:||..|.
  Fly  1094 RLTARSRDAAE----------TAINFYLTDMEN----DKTTSTLGYGQSLRKKQRALVVDGKTLT 1144

Yeast  1079 LALYGEDIRRK----FLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQ 1139
            ..|   |.:.|    ||.|.|.|.:|||||.:|.|||.:||:||:.|::.|||||||:|||:|||
  Fly  1145 FIL---DPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQ 1206

Yeast  1140 SADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFW 1204
            .||||:||:|:||.||||.:|:.:.:||||.||:|.||.|.|.||:.||..|||||..|...:||
  Fly  1207 MADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFW 1271

Yeast  1205 YGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRK 1269
            |.:|..|.|..:.:..|:|.|||.|||||.:.:|:.|:.|.:.:.|..|.||:.|.|...:....
  Fly  1272 YQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHD 1336

Yeast  1270 FLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDHRYFVGV--YVTTIAVISCNTYVLLH-- 1330
            |...:||.||||::.||.....|.::              .||:  :.|||.. ||....|:|  
  Fly  1337 FWLILLDALYQSLVIFFVALCAYAES--------------DVGIWEFGTTITA-SCLFANLVHCA 1386

Yeast  1331 -QYR-WDWFSGLFIALSC----LVVFAWTGIWSSAIASREFFKAAARIYGAPSFWAVFFVAVLFC 1389
             :.| |.....|.|.||.    |....:..:..:....|..:......:.:...|.|..::.:..
  Fly  1387 IEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYWVIFVCFASAVHWLVIMLSTVVA 1451

Yeast  1390 LLPRFTYDSFQKFFYPTD 1407
            :|||....:.:....|.|
  Fly  1452 VLPRLLLTTVRISLCPDD 1469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNF1NP_011093.3 PhoLip_ATPase_N 182..240 CDD:292826 25/58 (43%)
ATPase-Plipid 191..1413 CDD:273734 413/1390 (30%)
Cation_ATPase 776..883 CDD:289987 39/178 (22%)
HAD_like <1125..1156 CDD:304363 24/31 (77%)
PhoLip_ATPase_C 1156..1406 CDD:292829 82/260 (32%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 24/50 (48%)
ATPase-Plipid 250..1473 CDD:273734 413/1390 (30%)
E1-E2_ATPase 302..>394 CDD:278548 43/198 (22%)
Cation_ATPase <880..965 CDD:289987 33/90 (37%)
HAD_like <1177..1240 CDD:304363 40/63 (63%)
PhoLip_ATPase_C 1223..1468 CDD:292829 82/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 653 1.000 Inparanoid score I104
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.830

Return to query results.
Submit another query.