DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YARS1 and TyrRS-m

DIOPT Version :10

Sequence 1:NP_003671.1 Gene:YARS1 / 8565 HGNCID:12840 Length:528 Species:Homo sapiens
Sequence 2:NP_611967.1 Gene:TyrRS-m / 37965 FlyBaseID:FBgn0035064 Length:464 Species:Drosophila melanogaster


Alignment Length:214 Identity:42/214 - (19%)
Similarity:81/214 - (37%) Gaps:70/214 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    11 LHLITR--------------NLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIAD 61
            |||:.|              ||  :.|.|.:..:.::||:   :|..          :|:....:
  Fly   218 LHLLRRHNCCFQMGGSDQTGNL--MTGHELISRVERKREV---FGLT----------LPLVTTEE 267

Human    62 FLKAGCEVTILFADLHAYLD-NMKAPWELLELRVSYYENVIKAMLESIG-VPLEKLKFIKGTDYQ 124
            ..|.|..     |....:|| |..:|:.|.:..:...::.::.:|:... :||.:::       |
  Fly   268 GDKFGKS-----AGNAVWLDGNKTSPFALYQFFLRMPDSEVEKLLKLFTFIPLPQVE-------Q 320

Human   125 LSKEYTLDVYRLSSVVTQHDSKKA-------------GAEVVKQVEHPLLSGLLYPG-LQALDEE 175
            |.:|:|          .:.:.:||             |...:||.|.  ::..||.| ::.|.|.
  Fly   321 LMREHT----------KEPEKRKAQTLLAEDVTLLVHGESGLKQAER--VTNALYKGNVEGLAEL 373

Human   176 YL-KVDAQFGGIDQRKIFT 193
            .| ::...|.|.....:.|
  Fly   374 NLSEIQQTFQGATMVNLLT 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YARS1NP_003671.1 nt_trans 8..328 CDD:469580 42/214 (20%)
'HIGH' region. /evidence=ECO:0000269|PubMed:14671330 44..52 0/7 (0%)
'KMSKS' region. /evidence=ECO:0000269|PubMed:14671330 222..226
Nuclear localization signal. /evidence=ECO:0000269|PubMed:22291016 242..247
PLN02610 <327..528 CDD:215329
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 339..363
TyrRS-mNP_611967.1 TyrS 28..464 CDD:439932 42/214 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.