DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HXT17 and CG33282

Sequence 1:NP_014470.1 Gene:HXT17 SGDID:S000005355 Length:564 Species:Saccharomyces cerevisiae
Sequence 2:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster

Alignment Length:504 Identity:116/505 (23%)
Similarity:199/505 (39%) Gaps:122/505 (24%)


Yeast    64 ISFG-GFLPGWDSGITAGFINMD---NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCAIGGL 124
            |:|| |...||.|.........|   :|::|.              .::..|.:|..:....|.|
  Fly    27 ITFGHGVGVGWLSPTLTKIQTADSPLDFEVNL--------------AQISWLGSMLGLDSLCGNL 77

Yeast   125 IFARLADTLGRRLAIVIVVLVY-MVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEI 188
            ..|.|.:..||:..:.::...| .:..:|..:||  .|..:..:.:.|...|...::.|:.:||:
  Fly    78 TIAMLIERAGRKFCLYLMAGPYACIWILIYCASN--VYYLYAARFLCGFTGGAGYLVVPIFISEV 140

Yeast   189 APTDLRGGLVSLYQLNMTFGIFLGY-CSVYGTRKYDNTAQWRVPLGLCFLWTLIIIIGMLLVPES 252
            |.:::||.|.|:..|::..||..|| .|.|       .|...||. |..:..:...|..:::||:
  Fly   141 ADSNIRGALTSMVMLSVDLGILAGYILSTY-------LAYHVVPF-LAIILPVAYFIANIMLPET 197

Yeast   253 PRYLIECER----------HEEARASI----AKINKVSPEDPWVLKQADEINAGVLAQ--RELGE 301
            ..||::..:          :...|::|    :|:|            .:|:...||:|  |....
  Fly   198 APYLLKKSQLAAAENSFRYYRNQRSAICEQTSKVN------------FEELRTAVLSQQTRNATP 250

Yeast   302 ASWKELFSVKTK-VLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVG-LTDGFETSIVLGTVNF 364
            .|:|:|   .|| .|:.....|::....|.:|...|..|.:.|||:.| :.|....:|::|.|..
  Fly   251 LSYKDL---TTKPALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQI 312

Yeast   365 FSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKGAGNAMIVFTCF- 428
            .....:.::||.:|||..:|....|          :|:.|                  |.|.|| 
  Fly   313 VGVYTSTILVDIVGRRVLMLISTMG----------VGIGC------------------IAFGCFT 349

Yeast   429 -------------------YIFCFATTWAPVA--YIVVAESFPSKVKSRAMSISTACNWLWQFLI 472
                               .|.|:......:.  ::|:.|.||.|::|.|.|:|.    ::..|:
  Fly   350 YLAKIYDLSDFNWLPLVLMIIICYVANIGLIGIFFLVLVELFPVKIRSLATSLSV----IFLSLL 410

Yeast   473 GFFTPFITGSIHFYYGYVF-----VGCLVAMFLYVFFFLPETIGLSLEE 516
            .|.|..:...:..|:|..|     ....:..|.|.:.||.||.|.|:.|
  Fly   411 VFGTLKLFPLMLHYWGISFTMWFSAASALLTFFYFWLFLQETKGKSMIE 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HXT17NP_014470.1 Sugar_tr 60..521 CDD:278511 116/505 (23%)
MFS 64..507 CDD:119392 111/494 (22%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 109/492 (22%)
MFS_1 53..409 CDD:284993 93/427 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97245627
eggNOG 1 0.900 E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.