DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VBA1 and CG33282

Sequence 1:NP_013806.1 Gene:VBA1 SGDID:S000004694 Length:562 Species:Saccharomyces cerevisiae
Sequence 2:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster

Alignment Length:473 Identity:94/474 (20%)
Similarity:158/474 (33%) Gaps:94/474 (20%)


Yeast    53 STIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPL--------------------------Y 91
            :|::.||:.     |.......|::.:.....||..||                          .
  Fly    20 ATVIVNIIT-----FGHGVGVGWLSPTLTKIQTADSPLDFEVNLAQISWLGSMLGLDSLCGNLTI 79

Yeast    92 GKLSDITGRKSAL-LTAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTA 155
            ..|.:..|||..| |.|..:..:..|:.| |.||.....||.:||...|....:..|.:|::..:
  Fly    80 AMLIERAGRKFCLYLMAGPYACIWILIYC-ASNVYYLYAARFLCGFTGGAGYLVVPIFISEVADS 143

Yeast   156 RERGVYQGYANIVFGFGQLLGAPLGGVFIETIGWRALFGIQVPVIMLCSVLAIKNINIKLFHVPP 220
            ..||.......:....|.|.|..|.......:         ||.:.:...:|....||.|....|
  Fly   144 NIRGALTSMVMLSVDLGILAGYILSTYLAYHV---------VPFLAIILPVAYFIANIMLPETAP 199

Yeast   221 MKERYTLKNLSRIDIFGSLSLVATISGVLFLCSSQLN--KLYLALFT------------------ 265
                |.||.........|..........:...:|::|  :|..|:.:                  
  Fly   200 ----YLLKKSQLAAAENSFRYYRNQRSAICEQTSKVNFEELRTAVLSQQTRNATPLSYKDLTTKP 260

Yeast   266 -IGSFIVFILVERYYATEKILPF-ELLTRSFCLS-SAVTVISSFVVFGEIFRSPIYLQLLQNISV 327
             :..|...|::...|....:..| ..::..|..| |.|.|.::.::.|.:....:|...:. :.:
  Fly   261 ALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVGVYTSTIL-VDI 324

Yeast   328 TKTGLFLIFPSISVAVGSLVTGWVLRNTKI------NLAHCAYQIIFGGMIMQLLGLGL-GYFLL 385
            ....:.::..::.|.:|.:..|......||      |.......||    |..:..:|| |.|.|
  Fly   325 VGRRVLMLISTMGVGIGCIAFGCFTYLAKIYDLSDFNWLPLVLMII----ICYVANIGLIGIFFL 385

Yeast   386 SHLNPDYTIYDMLESITFRSNSIWWKLIYVFASVLVSFGYACL--LVATLVSIVFTVEKSQQGTM 448
            .          ::|....:..|:...|..:|.|:|| ||...|  |:.....|.||:..|....:
  Fly   386 V----------LVELFPVKIRSLATSLSVIFLSLLV-FGTLKLFPLMLHYWGISFTMWFSAASAL 439

Yeast   449 TGVFYLWRSIGNVLGASL 466
            ...||.|..:....|.|:
  Fly   440 LTFFYFWLFLQETKGKSM 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VBA1NP_013806.1 MFS 39..480 CDD:119392 94/474 (20%)
MFS_1 42..464 CDD:284993 93/470 (20%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 92/462 (20%)
MFS_1 53..409 CDD:284993 70/385 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.