DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG31103

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_001097914.1 Gene:CG31103 / 43030 FlyBaseID:FBgn0051103 Length:506 Species:Drosophila melanogaster

Alignment Length:408 Identity:89/409 (22%)
Similarity:162/409 (40%) Gaps:98/409 (24%)


Human   164 GVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYLVVG-- 226
            |:.|.:..:||.||.:|||.||        |:|..|:.|:.:........:|..:.:  |:||  
  Fly    79 GIFLSTYIWGYISDDIGRRRVL--------LYGNFASNALQFVLMFVTSVWLFNIIN--LLVGIS 133

Human   227 --------FVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALTGYLV--------------RTWWL 269
                    :.|:.||...:.|..|..:...|.:|..:.|..|.:||              |.|.|
  Fly   134 VGAVSAALYAYLSEFNIPRHRAVAINYSTMFVSVTAIYVPATAWLVLSSNWAITMGDFVFRPWRL 198

Human   270 YQMILSTVTVPFI--LCCWVLPETPFWLLSEGRYEEAQKIVDIMAKWNRASSCKLSELLSLD--- 329
              ::|.::...||  |.....||:|.:|||:.:..||.:.|..::|:||..|  :.::||.|   
  Fly   199 --LLLVSLLPGFIGGLILLYYPESPKFLLSQEKNNEAIEAVAWISKFNRGKS--IQQVLSCDEFT 259

Human   330 --LQGPVSNS-------------------PTEVQKHNLSYLFYNWSITKRTLTV--WLIWFTGSL 371
              .:.||..:                   |...:.|..:::..|.::.....:.  ..:||...:
  Fly   260 LKSEDPVGENLLGESQGCGILSKICRATIPLFHKPHGFNFILCNLALFGMFFSSNGMQLWFPEIV 324

Human   372 GFYSFSLNSVN------------------------LGGNEYLNLFLLGVVEIPAYTFVCIAMDKV 412
            ...|.:.|:.:                        :....|::..::|...:..::...:.::.:
  Fly   325 NRSSGAENNSSTVCEILSVPVEQPNVTETLDCTDPISSKTYIDNLVVGFAFLIGFSIQGLILNPL 389

Human   413 GRRTVLAYSLFCSALACGVV---MVIPQKHYILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVR 474
            ||:.||..:|..:.|: ||:   |..|....:|..:..::...:|....|.|    .:|.||.:|
  Fly   390 GRKNVLLAALAVATLS-GVLLHFMESPTGVLVLFCLYILLPGLSISIMIGAI----VDLVPTHLR 449

Human   475 SLAVGSGSMVCRLASILA 492
            |.||.....:.||..|.|
  Fly   450 SKAVSFCMSLGRLGIIAA 467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 89/409 (22%)
CG31103NP_001097914.1 2A0115 29..475 CDD:273327 89/409 (22%)
MFS 34..>189 CDD:119392 30/120 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62666892
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.