DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG4462

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_650849.1 Gene:CG4462 / 42376 FlyBaseID:FBgn0038752 Length:573 Species:Drosophila melanogaster

Alignment Length:619 Identity:132/620 (21%)
Similarity:218/620 (35%) Gaps:178/620 (29%)


Human     9 IYDHVGHFGRFQR---VLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPGNVSQVVFHNHSNWS 70
            |.|.||.||.:|.   ::.|:|...         |:.||      .|        ::|       
  Fly    43 IADVVGDFGIWQLRTILIIFLCKIP---------AAWFM------AC--------IIF------- 77

Human    71 LEDTGALLSSGQKDYVTVQLQNGEIWELSRCSRNKRENTSSLGYEYTGSKKEFPCVDG--YIYDQ 133
               ||..|..|.                        |.|....|..:.|...|...|.  |:.|:
  Fly    78 ---TGPELYPGS------------------------EFTCDTSYLTSSSNSSFSISDNQCYVLDE 115

Human   134 NTWKS-------------TAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVL 185
            :|..|             :.:.|:||||.|.......|...:||||:|.|        :|.:::|
  Fly   116 STGTSSECEQFNYVSSFDSLIMQFNLVCLRDIFVAWTQYWHLFGVLVGGV--------MGTKMML 172

Human   186 WATSSSMF--------LFGIAAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTWA 242
            ..:..|.:        |.|:...:|.|:....|.|...|:..:.....|.....:......|..|
  Fly   173 GISPRSTYCVGAVAQILCGVVTGYARDFSLHCAFRCLSAVCCAIMFTAGQAIFADITAGMHRIGA 237

Human   243 SVHLHSFFAVGTLLVALTGYLVRTWWLYQMILSTVTVPFILCCWVLPETPFWLL--SEGRY--EE 303
            .:...:|:::|.:|:........:|.|..:.::..|:..||..:..|::|.|||  :..|:  :.
  Fly   238 IILYDTFWSIGVILLPGLSSFFNSWSLIYVGITFPTIMLILLLYWTPDSPRWLLRHAADRFSIDN 302

Human   304 AQKIVDIMAKWNRASSCKLS-------ELLSLDLQGPVSNSP-TEVQK------HNLSYLFYNWS 354
            .::|:...|..| ..|.|:.       |.||..|:.....:| ||:.|      |.::       
  Fly   303 VEQILREGAAIN-DRSFKIPPDFRQQLEQLSERLKAQPPPAPWTELWKGKRAKTHMVA------- 359

Human   355 ITKRTLTVWLIWFTGS-LGFYSFSL-----NSVNLGGNEYLNLFL---------------LGVVE 398
             ....|..::|.|.|. |...||..     |::.:|.:|.:..||               .||..
  Fly   360 -AHLALAFFVINFMGMLLNIRSFGRDYLVPNTIAMGFSEIIGCFLALHFTLKHNKWKWQCAGVFN 423

Human   399 IPAYTFVCIAMDKVGRRTVLAYSLFCSALACGVVMVIPQKHYILGVVTAMVGKFAIGAAFGLIYL 463
            |.|....|:..            :|.:|.:....:.:.     |.::.|.:.|.|:..|..:|..
  Fly   424 ILAGILGCMGW------------IFTNADSMDADLKVS-----LWMIIATIPKAAVSCAQSMILA 471

Human   464 YTAELYPTIVRSLAVGSGSMVCRLASILAPF---------SVDLSSIWIFIPQLFVGTMALLSGV 519
            ...||.|...:.|.|.|.....|:..:.|||         ::.|:|..:|         ::|.|:
  Fly   472 CMNELMPANKKQLFVFSVVTWARVWLLSAPFFNVLRKIDTAMSLTSYCVF---------SILGGI 527

Human   520 LTLKLPETLGKRLATTWEEAAKLESENESKSSKL 553
            .|..|   |..||:.: .....||..|..:.|.|
  Fly   528 CTSLL---LTPRLSVS-PVVPHLEQRNTKEQSPL 557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 124/595 (21%)
CG4462NP_650849.1 2A0119 <126..532 CDD:273328 95/449 (21%)
MFS 149..>284 CDD:119392 28/143 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109625634
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.