DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG17752

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_650817.1 Gene:CG17752 / 42337 FlyBaseID:FBgn0038718 Length:538 Species:Drosophila melanogaster

Alignment Length:614 Identity:130/615 (21%)
Similarity:235/615 (38%) Gaps:135/615 (22%)


Human     9 IYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPGNVSQVVFHNHSNWSLED 73
            :.:..|:||.:|.:|..:..:.||...:||.:...:..||.|.|..|                  
  Fly     6 VLEKCGNFGPYQILLLGLYGYTNIVSSLHYFSQTLISFTPSHRCSAP------------------ 52

Human    74 TGALLSSGQKDYVTVQLQNGEIWELSRCS--------RNKRENTSSLGYEYTGSKKEFPCVDGYI 130
                          |:..:....||..||        .:.|:|..|                .:.
  Fly    53 --------------VEEFSQNFTELLSCSVIQYDVDMTSFRDNKCS----------------SWD 87

Human   131 YDQNTWKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRR---VVLWATSSSM 192
            :|:.:...:..|:...|||..:...:.|..|..|..|||:.|||.:||:||.   |:...|.:|.
  Fly    88 FDKESNYESITTELEWVCDDAYKLAVGQSFFFIGSALGSIFFGYLADRIGRLPACVLSTLTGASG 152

Human   193 FLFGIAAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTWA-SVHLHSFFAVGTLL 256
            ..|   .:|......|...||...:......|:.::.|.|::..:.||:. ::.|..|:::|.::
  Fly   153 DFF---TSFVGSLPMFSFTRFISGLSMDTQYVLMYILVFEYLSPQHRTFGLNIILGVFYSIGLMI 214

Human   257 VALTGYLVRTWWLYQMILSTVTVPFILCCWVLPETPFWLLSEGRYEEAQKIVDIMAKWN------ 315
            .......:..|..|....|...:..::....|.|:..|||::|::::|...:..:||:|      
  Fly   215 SPWIAIWLGNWRSYLWAASLPALGMLIFPLFLHESVEWLLTKGKFDKAVNNLKSVAKFNGRQVED 279

Human   316 --------------RASSCKLSELLSLDLQGPVSNSPTEVQKHNLSYLFYNWSITKRTLTVWLIW 366
                          .::..|.|:.....|:.|      .::|..:..|..:..||          
  Fly   280 SVFDEFIKHYREKLNSAQKKSSDTFMGMLRTP------RLRKFTIILLIKSMIIT---------- 328

Human   367 FTGSLGFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAYSLFCSALACGV 431
                :.|...|.|...:|.:.:......|.|.:|....:.:..:|:||:     .:.|::|..| 
  Fly   329 ----IAFDILSRNVEGVGISPFKLFSYSGFVVLPGGLSIILFQNKIGRK-----GMACASLLVG- 383

Human   432 VMVIPQKHYILGVV-----TAMVGKFAIGAAFGLIYL------YTAELYPTIVRSLAVGSGSMVC 485
            ..:.....|::|.:     :.::|.....|.||.:..      |.||:.||.||...|.:..:|.
  Fly   384 AFITATTGYLVGTLDPANYSVLLGFMVCLARFGAVVAYDAEAQYAAEIIPTSVRGRGVANIHVVG 448

Human   486 RLASILAPFSVDLSSIWIFIPQLFVGTMALLSGVLTLKLPETLGKRLATTWEEA---AKLES--- 544
            ...:..:.:.:.|.:.:..:|.|.:..:.::...|.|.|||||.|:|..|.||.   ||.|.   
  Fly   449 NAFAFFSSYIIYLGTFYKPLPSLLISFLLIIGACLCLTLPETLHKQLPQTLEEGEIFAKGEKWYF 513

Human   545 ----ENESKSSKLLLTTNNSGLEKTEAIT 569
                ..:.:|:|     :.|.||....||
  Fly   514 FPCFSRKRQSNK-----SESQLESANEIT 537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 117/564 (21%)
CG17752NP_650817.1 2A0119 11..498 CDD:273328 117/564 (21%)
MFS 116..488 CDD:119392 83/401 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C59537789
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.