DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG7342

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_001247196.1 Gene:CG7342 / 42335 FlyBaseID:FBgn0038716 Length:540 Species:Drosophila melanogaster

Alignment Length:620 Identity:138/621 (22%)
Similarity:246/621 (40%) Gaps:151/621 (24%)


Human     9 IYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRP--PGNVSQVVFHNHSNWSL 71
            |.:..|.|.|.|.::..:....|:...:||.:...:...|.:.|..  |.::...|         
  Fly     7 ILEKCGDFSRLQMIMLLLFCVINVLSALHYYSQTIISFVPKYWCADGLPASIESPV--------- 62

Human    72 EDTGAL-LSSGQKDYVTVQLQNGEIWELSRCSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNT 135
             |:..| |:.......|....|.|::               :||:...|:.::.|.|       .
  Fly    63 -DSSCLPLNRNISTPNTCYSYNYELY---------------MGYQSFPSEMDWVCAD-------A 104

Human   136 WKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVL--------------- 185
            ||.|                |.|.:|..|.::||:..||.:|.:||..:|               
  Fly   105 WKLT----------------LGQSMFFVGSVVGSMVLGYLADVVGRLPILIVANLIAMTGNLLTI 153

Human   186 WATSSSMF-LFGIAAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTWA-SVHLHS 248
            |:|:.::| :|.:.:..|.|               |.:::: ::.|||::....||.. |:.:..
  Fly   154 WSTNVTLFCMFRMISGIATD---------------SNFVMM-YILVMEYMRPSVRTLGLSICIGF 202

Human   249 FFAVGTLLVALTGYLVRTW--WLYQMILSTVTVPFILCCWVLPETPFWLLSEGRYEEAQKIVDIM 311
            |:.:|::.......|:|:|  :|....|..:.|||...  ::||:..||:|:.:|:.|...:..:
  Fly   203 FYCLGSMAAPWIAVLMRSWRGFLLTTSLPLLVVPFFYL--IVPESIQWLISKQKYDSAVVCLKRV 265

Human   312 AKWNR-----------ASSCKLSE--------LLSLDLQGPVSNSPTEVQKHNLSYLFYNWSITK 357
            ||.|.           ...||.|:        ||.| .|.|      .:::|.|...|.:..|| 
  Fly   266 AKINGRHVEESAYAEFIEECKCSQQNQKASPHLLDL-FQTP------RLRRHTLILFFKSMVIT- 322

Human   358 RTLTVWLIWFTGSLGFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAYSL 422
                         |.:.:.|.|...||.:.::...|.....:||...:....|::||:.:.:.||
  Fly   323 -------------LCYDAVSRNVQGLGISPFVMFSLSATAILPACLLIIALQDRIGRKAMASASL 374

Human   423 FCSALACGVVMVI------PQKHYILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSG 481
            ..|.:...|...|      ..|...|.|..::||:|.:..|:.....|..||.||.||...|.:.
  Fly   375 LLSGIFISVTGGIIFAASASDKTTTLLVSLSVVGRFGVTVAYNSGAQYATELIPTCVRGQGVAAV 439

Human   482 SMVCRLASILAPFSVDLSSIWIFIPQLFVGTMALLSGVLTLKLPETLGKRLATT----------- 535
            .:.....:..:.:.:...|::..:|::.:|.::||...|.|.|||||.:.|.|:           
  Fly   440 HVAGYAFTFFSAYILFTRSVFSPLPEIILGVLSLLGACLCLLLPETLHRTLPTSLEDGENFGKND 504

Human   536 -WEEAAKLESENESKSSKLLLTTNNSGL--EKTEA 567
             |...:.||...:|.::   |.|.|:.:  :.||:
  Fly   505 RWYTFSFLEGRTQSAAT---LDTQNAKMYSQSTES 536

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 128/568 (23%)
CG7342NP_001247196.1 2A0119 12..491 CDD:273328 127/566 (22%)
MFS 93..>243 CDD:119392 41/191 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C59537452
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.