| Sequence 1: | NP_149116.2 | Gene: | SLC22A16 / 85413 | HGNCID: | 20302 | Length: | 577 | Species: | Homo sapiens | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001247196.1 | Gene: | CG7342 / 42335 | FlyBaseID: | FBgn0038716 | Length: | 540 | Species: | Drosophila melanogaster | 
| Alignment Length: | 620 | Identity: | 138/620 - (22%) | 
|---|---|---|---|
| Similarity: | 246/620 - (39%) | Gaps: | 151/620 - (24%) | 
- Green bases have known domain annotations that are detailed below.
| 
Human     9 IYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRP--PGNVSQVVFHNHSNWSL 71 
Human    72 EDTGAL-LSSGQKDYVTVQLQNGEIWELSRCSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNT 135 
Human   136 WKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVL--------------- 185 
Human   186 WATSSSMF-LFGIAAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTWA-SVHLHS 248 
Human   249 FFAVGTLLVALTGYLVRTW--WLYQMILSTVTVPFILCCWVLPETPFWLLSEGRYEEAQKIVDIM 311 
Human   312 AKWNR-----------ASSCKLSE--------LLSLDLQGPVSNSPTEVQKHNLSYLFYNWSITK 357 
Human   358 RTLTVWLIWFTGSLGFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAYSL 422 
Human   423 FCSALACGVVMVI------PQKHYILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSG 481 
Human   482 SMVCRLASILAPFSVDLSSIWIFIPQLFVGTMALLSGVLTLKLPETLGKRLATT----------- 535 
Human   536 -WEEAAKLESENESKSSKLLLTTNNSGL--EKTEA 567 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| SLC22A16 | NP_149116.2 | Sugar_tr | 14..535 | CDD:331684 | 127/567 (22%) | 
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 543..577 | 7/27 (26%) | |||
| CG7342 | NP_001247196.1 | 2A0119 | 12..491 | CDD:273328 | 126/565 (22%) | 
| MFS | 93..>243 | CDD:119392 | 41/190 (22%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165153545 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG57756 | |
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X24 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.850 | |||||