DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG6126

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_650528.1 Gene:CG6126 / 41967 FlyBaseID:FBgn0038407 Length:555 Species:Drosophila melanogaster

Alignment Length:564 Identity:182/565 (32%)
Similarity:279/565 (49%) Gaps:72/565 (13%)


Human     7 EGIYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPG--NVSQVVFHNHSNW 69
            |.:...:|.||::|.:.:|:.....::.|:|.|:.|.:...|.|.|...|  |.|..|    :.|
  Fly     8 EDLMGKLGEFGKYQFLQFFLQVLSGLTAGMHMLSLVTVAAVPEHRCFIEGVDNSSLSV----TPW 68

Human    70 SLEDTGALLSSGQKDYVTVQLQ-NGEIWELSRCSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQ 133
               ::.|:|::       :.|: |||:           |:.........|:.....| :.|:||.
  Fly    69 ---NSSAILAA-------IPLKPNGEL-----------ESCLMFDPSSPGTNTTINC-ERYVYDT 111

Human   134 NTWKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFGIA 198
            ..:|::....||.||||:|:..::|.:||.||..|:||.|..:|::||:.|...::....:.|:.
  Fly   112 TYYKTSRTIDWNFVCDRRWMGAIVQTVFMLGVFTGAVTLGGLADKVGRKTVFCWSALFQLIIGVG 176

Human   199 AAFAVDYYTFMAARFFLAMVAS-GYLVVGFVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALTGY 262
            .||..:|::||.||:.|.:|.| |..:.|||..||.:|...||...:...:.||.|.:|||..|.
  Fly   177 VAFIPEYFSFMVARYLLGIVGSAGAYICGFVLTMELVGPTKRTVCGITFQAVFAGGIMLVAGWGA 241

Human   263 LV--RTWWLYQMILSTVTVPFILCCWVLPETPFWLLSEGRYEEAQKIVDIMAKWNRASSCKLSEL 325
            |:  |.|  .|:|.......|:...|.|.|:|.||..:||..||   |||:||..|.:...:   
  Fly   242 LIPDRQW--LQVIYGLHGCLFLGHWWWLDESPRWLWMQGRAAEA---VDIVAKGLRINGSGI--- 298

Human   326 LSLDLQGPVSN-----------SPTEVQKHNLSYLFYNWSITKRTLTVWLIWFTGSLGFYSFSLN 379
                   ||..           :..|.....||.||...::..:||.|.|.||..||.:|..||:
  Fly   299 -------PVDKEYYVQKAKQQAAAEEKSSAGLSDLFRTPNLRMKTLNVCLCWFANSLVYYGLSLS 356

Human   380 SVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAYSLFCSALACGVVMVIPQKHYILGV 444
            :..|.||.||.||::|:||.|:|..:...:|::|||::.:..:....|.|.|...|.|     |.
  Fly   357 AGKLYGNPYLILFIMGLVEFPSYITIVFVLDRLGRRSITSTLMLGGGLCCIVAAYIAQ-----GS 416

Human   445 VTA----MVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSGSMVCRLASILAPFSVDLSSIWIFI 505
            .|:    |.||..|..:|.:||.|:|||:||:||:.|:|.|||..||:..|.|....|.|....|
  Fly   417 TTSTAVVMAGKLLIAGSFAVIYNYSAELFPTVVRNSAMGLGSMCARLSGALTPLITLLDSFDPKI 481

Human   506 PQLFVGTMALLSGVLTLKLPETLGKRLATTWEEAAKLESENESK 549
            |.:..|.:||:||...:.||||:.:.:..:.|     :.||..|
  Fly   482 PAVLFGVVALISGFWVMFLPETMNQPMPESIE-----DGENFGK 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 177/542 (33%)
CG6126NP_650528.1 2A0119 15..510 CDD:273328 177/541 (33%)
MFS 130..501 CDD:119392 138/391 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D386678at33208
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 1 1.000 T609463
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1933
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.