DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG8925

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_650526.1 Gene:CG8925 / 41963 FlyBaseID:FBgn0038404 Length:670 Species:Drosophila melanogaster

Alignment Length:548 Identity:155/549 (28%)
Similarity:240/549 (44%) Gaps:75/549 (14%)


Human    15 HFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHV-------------CRPPGNVSQVVFHNH 66
            |....:|:|..:..:|::.|.   |.|:|..:...|:             |..|.|:.|:.....
  Fly   146 HTKLLERLLGCLTPWQSMWCA---LLSIFQAICTFHIFVYVFQIAPKDFWCARPENLMQMSVSEW 207

Human    67 SNWSLEDTGALLSSGQKDYVTVQLQNGEI--WELSRCSRNKRENTSSLGYEYTGSKKEFPCVDGY 129
            .|.|....|.||.  ..||..|..:|.::  |.         ||.:.|||.... ..||..|||.
  Fly   208 RNISQSSNGCLLL--DVDYTQVTYENNQLINWP---------ENATDLGYRQCW-HFEFSDVDGS 260

Human   130 IYDQNTWKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLWATSSSMFL 194
                   ..|.|.:::|||.|..|: |::..|:.|...|:|..|:.|||.|||..|.|..:...:
  Fly   261 -------AKTLVQEFDLVCGRDILS-LVETCFLVGAAAGAVLSGWISDRFGRRHTLMAFVTIQSV 317

Human   195 FGIAAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTWASVHLHSFFAVGTLLVAL 259
            ||...||:.....||:.|..:...:....||.||.|:|.:..|.||...:......|:..:|.|.
  Fly   318 FGGILAFSTSVAMFMSLRVIIGFASMTVTVVSFVLVVELVSGKWRTVIGILNILPVAISYVLSAG 382

Human   260 TGYLVRTWWLYQMILSTVTVPFI--LCCWV-LPETPFWLLSEGRYEEAQKIVDIMAKWNRASSCK 321
            ..||:|.|...|:.:|.   |::  |..|. |||:|.|||::||.:|...:::..|:.|..|:..
  Fly   383 LAYLIRDWRHLQLAISW---PWLIMLSIWFWLPESPRWLLAQGRLDELCGLIERAARMNGTSASL 444

Human   322 LS------------------------ELLSLDLQGPVSNSPTEVQKHNLSYLFYNWSITKRTLTV 362
            .|                        |..:::...|..::...|....:.:....|..|..||.:
  Fly   445 PSNYRKTLEAAVPRAVQSPPEATTSVESKAVEADAPDPSASGHVNPLLVVFSAKYWRTTCLTLVI 509

Human   363 WLIWFTGSLGFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVG-RRTVLAYSLFCSA 426
            ||   |..:.::..:|:..|||||.|:|..:.|.||..:.....:.:.||| ||:::.|.|. ..
  Fly   510 WL---TLIIIYFGLTLHLSNLGGNIYINSAVAGTVEAISICISILVVLKVGIRRSLIGYMLL-PG 570

Human   427 LACGVVMVIPQKHYILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSGSMVCRLASIL 491
            |.|....::..:..::.:.|  :.|..|||...:|..|||..||||||:..||.|::...:|.||
  Fly   571 LCCLATNLVSNQTGVIALAT--IAKCLIGANNAIIPTYTAMQYPTIVRNFGVGMGNLASGIALIL 633

Human   492 APFSVDLSSIWIFIPQLFVGTMALLSGV 519
            .||...|..|...:|...:|...|:..|
  Fly   634 VPFLWKLEHIDPLLPLNVMGVCGLIGAV 661

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 155/549 (28%)
CG8925NP_650526.1 MFS 277..667 CDD:119392 116/396 (29%)
MFS_1 277..635 CDD:284993 108/368 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D386678at33208
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.