DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG6006

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_001097812.1 Gene:CG6006 / 41962 FlyBaseID:FBgn0063649 Length:603 Species:Drosophila melanogaster

Alignment Length:558 Identity:152/559 (27%)
Similarity:263/559 (47%) Gaps:63/559 (11%)


Human     9 IYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPGNVSQVVFHNHSNWSLED 73
            |.|.:||:|::|.::..:.:...:....|..:|::........|:.|..:..:......|     
  Fly    85 IGDLMGHYGKWQLLMTVLLSLFQVPNTFHISSSIYQAANKDFWCQRPAQLQHMPVATWRN----- 144

Human    74 TGALLSSGQKDYVTVQLQNGEIWELSRCSRNKRENTSSLGYEYTG--SKKEFPCVDGYIYDQ--- 133
                 .||..|       |...||....|:...|.|....::...  .||...| :.:.|:.   
  Fly   145 -----LSGSVD-------NCRRWEGIDWSQVSNETTLPSDWKTPAEMDKKLVAC-EKWEYETNDN 196

Human   134 --NTWKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFG 196
              |||.|    ||:|||:::.|..:.:..|:.||..|.:..||.||:.||:.:|:.::....:||
  Fly   197 VGNTWTS----QWDLVCEKEHLKNVAEMFFLLGVATGGIISGYLSDKFGRKTMLFISAVLQTIFG 257

Human   197 IAAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALTG 261
            :.......:..::..|..|.:|:......|.:..:|::..|.||.|.::......:..::::...
  Fly   258 LWLYICSSFELYLTLRALLGLVSVSVTYSGLILAIEYVDGKWRTIAGMYNLFPLPISYMIISGLA 322

Human   262 YLVRTWWLYQMILSTVTVPFILCC--W-VLPETPFWLLSEGRYEEAQKIVDIMAKWNRASSCKLS 323
            ||.:.   ||.:...:.:|.|..|  | |:||:|.|||.:||.:|.::|::..||:|       .
  Fly   323 YLTQD---YQRLQLCIGIPGIFLCFLWFVVPESPRWLLVKGRIDEVRRIIEAAAKFN-------G 377

Human   324 ELLSLDLQ--GPVSNSPTEVQKHNLSYLFYNWSITKRTLTVWLIWFTGSLGFYSFSLNSVNLGGN 386
            ..|..|.|  .|...|.|:    :::|||.:..:.:.::..:.||||.:|.:|...||..:.|||
  Fly   378 RQLPADYQLTPPTQESSTQ----DVTYLFRSSYLRRISICFFCIWFTMNLVYYGIILNMSSFGGN 438

Human   387 EYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAYSLFCSALACGVVMVIPQKH---YILGVVTAM 448
            .|||..|.|:|||||.......:.|||::.:...:|.|:.:|| ....|.:.|   ..|.:...|
  Fly   439 VYLNSALAGLVEIPAIAVAMYIITKVGKKWLFCATLICAGVAC-CCAAITEGHADLLWLKITFLM 502

Human   449 VGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSGSMVCRLASILAPFSVDLSSIWIFIPQLFVGTM 513
            :|||.|.|...::.:||||||||.:|::.||:.::...||.||.|:...|:.|...:....:...
  Fly   503 MGKFTISAGNTIMPVYTAELYPTPIRNVGVGACNVAAGLALILTPYLSLLNKIEGHLLMTLLTAW 567

Human   514 ALLSGVLTLKLPETLGKRLATTWEEAAKLESENESKSS 551
            ::..|.:.|.||||           |.:.:::|:..||
  Fly   568 SIFGGFVVLFLPET-----------AVRQKTDNQGGSS 594

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 146/536 (27%)
CG6006NP_001097812.1 2A0119 90..581 CDD:273328 145/528 (27%)
MFS 222..579 CDD:119392 111/372 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D386678at33208
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.