DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG14857

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_650392.1 Gene:CG14857 / 41791 FlyBaseID:FBgn0038262 Length:560 Species:Drosophila melanogaster

Alignment Length:561 Identity:134/562 (24%)
Similarity:224/562 (40%) Gaps:85/562 (15%)


Human     6 FEGIYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPGNVSQVVFHNH-SNW 69
            |:.|.:..|..||:|.::..:..:...:..:||.:...:|..|.|.|          :|.. .|.
  Fly     3 FDQILEKCGSAGRYQYLMILLLGYIAFTTTVHYYSQNIIGFVPQHWC----------YHEALENR 57

Human    70 SLEDTGAL------------LSSGQKDYVTVQLQNGEIWELSRCSRNKRENTSSLGYEYTGSKKE 122
            |.|:..|:            |...:.|.|||..:..:.|.                         
  Fly    58 SFEEIAAIYAPFGKEASCTRLDKIEGDRVTVSNETCQRWI------------------------- 97

Human   123 FPCVDGYIYDQNTWKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGR-RVVLW 186
                  |.||.......|...|  ||:..:.|.:.|.||..|.|:|:.|||...||:|| |.|:.
  Fly    98 ------YNYDFGFRSMNAELNW--VCNDAYKARIGQSLFFLGSLMGTFTFGVLGDRIGRVRAVIL 154

Human   187 ATSSSMFLFGIAAAFAVDYYTFMAARFF--LAMVASGYLVVGFVYVMEFIGMKSRTWA-SVHLHS 248
            |.... |:......:|.:...|...|..  ||..|:.||:  |:.|:|::..|.|..| |..|..
  Fly   155 ANQCG-FVGDFLTTYASNLVQFAIFRCISGLAATANYYLM--FILVLEYLAPKLRNMAISGTLGI 216

Human   249 FFAVGTLLVALTGYLVRTWWLYQMILSTVTVPFILCCWVLPETPFWLLSEGRYEEAQKIVDIMAK 313
            .|.:|.|:......|...|.:|....:.:.:...|..:|:.|:..||::....|.|...:..:|.
  Fly   217 CFCLGALVAPWLSVLAGNWRIYLTCSALLQLVVALFYFVVQESAQWLITRTNVEGAIARLKHIAH 281

Human   314 WNRASSCKLSELLSLDLQG---------PVSNSPTEVQKHNLSYLFYNWSITKRTLTVWLIWFTG 369
            :|.      .|:.:.|.:.         .:||.|.  |...:..|....::.|.:|.|...:...
  Fly   282 FNG------MEVKAADFEAFRRNCIVKRKLSNQPE--QTAGIFDLLRTPNLRKVSLLVVFTFMLT 338

Human   370 SLGFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAYSLFCSAL---ACGV 431
            ||.|.:.|.|...:|.:.::...|..||..|:.....:...:|||:.....::.|:.|   |.||
  Fly   339 SLSFNTISRNVEGMGLSPFVVFSLFAVVVPPSGFIQGLLQSRVGRKATAFLAMLCTGLLSCALGV 403

Human   432 VMVI--PQKHYILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSGSMVCRLASILAPF 494
            .:..  .||:..|.:..|:..:..|...:.:...:.:||.||.|||..:.:..:....||.::|:
  Fly   404 ALSTEGAQKNVTLLLAFALPMRLGISMCYTVTSQFASELLPTCVRSRGIAAVHLAAAGASFVSPY 468

Human   495 SVDLSSIWIFIPQLFVGTMALLSGVLTLKLPETLGKRLATT 535
            .:.|.:.....|.|.:..:.|.:...||.||||..::|..|
  Fly   469 LIHLGTKLAAAPSLILALLLLTASGCTLMLPETNNRQLPIT 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 131/552 (24%)
CG14857NP_650392.1 2A0119 11..509 CDD:273328 131/552 (24%)
MFS 126..470 CDD:119392 90/355 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C59537255
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.