DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG14691

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_650012.2 Gene:CG14691 / 41287 FlyBaseID:FBgn0037829 Length:522 Species:Drosophila melanogaster

Alignment Length:472 Identity:98/473 (21%)
Similarity:182/473 (38%) Gaps:160/473 (34%)


Human   164 GVLLGSVTFGYFSDRLGRRVVL----WATSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYLV 224
            |:::.:|.:|:.:|.:|||.||    |...    .|.:.|:.:.:....||.:||..::..|...
  Fly    77 GMIISAVPWGFIADTIGRRPVLISGGWLDG----FFVLCASLSQNTAQLMAFKFFDGLIICGPFA 137

Human   225 VGFVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALTGYLV--------------RTWWLYQMILS 275
            |...|:.||.|.|.|.:..:.:....::|::::.|..||:              |||   |:.|:
  Fly   138 VVVSYLAEFHGKKHRPYIMLFVGLCVSIGSMILPLLSYLLLPVPILFTVSSMKFRTW---QVFLA 199

Human   276 TVTVPFILCCWV---LPETPFWLLSEGRYEEAQKIVDIMAKWNRASSCKLSELLSL--------- 328
            ..:.|.:|..::   |||:|.:|:|:|.|::|...:..:.|.|:..|.:...:..|         
  Fly   200 VSSAPSLLSGFLHIFLPESPKFLMSQGNYKKALDSLQRIYKLNKRKSRESYPIKHLTDPTPDRSD 264

Human   329 DLQG--------------------------PVSNSPTEVQKHNLSYLFYNWSITKRTLTVWL--I 365
            ||.|                          |:.:||.......:..|.:...:...::.:||  |
  Fly   265 DLDGTGRPSTLQERFSRAQSKFIDGFKQLKPMFSSPYLAISLQVYCLHFCQIMCVNSVRLWLPQI 329

Human   366 WFT----GSLGFYSFSL--------NSVNLGGNE-------------YLN------LFLLGVVEI 399
            :.|    .:||....|:        |:.::...|             |||      :.|:|.:.|
  Fly   330 FATMNAMDTLGANDTSMCAVLEHNANAKSMDEEEKRVECALHHDPDSYLNNITVAGIGLVGFLII 394

Human   400 --------------PAYTFVCIAMDKVGRRTVLAYSLFCSALACGVVMVIPQKHYILGV-VTAMV 449
                          ..:.|:||.:  ||       ||:....:...:||......::|: .|.::
  Fly   395 FPLMRFQVVSNHILKVFLFICIFL--VG-------SLYFVKTSLVTMMVSAVYLTMMGICATTII 450

Human   450 GKFAIGAAFGLIYLYTAELYPTIVRSLAV-----------GSGSM---VCRLASILAPFSVDLSS 500
            |...:             ::||::|::.:           .||:|   |....|.||||      
  Fly   451 GMSVV-------------IFPTLMRTMVLLLIMTFGRLGSVSGNMLLPVFMQLSCLAPF------ 496

Human   501 IWI-------FIPQLFV 510
            :|:       |:..||:
  Fly   497 LWLCSLMSIAFLFSLFL 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 98/473 (21%)
CG14691NP_650012.2 MFS 30..>216 CDD:119392 36/146 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C100806311
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.