DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG44098

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_001262264.1 Gene:CG44098 / 40590 FlyBaseID:FBgn0264907 Length:813 Species:Drosophila melanogaster

Alignment Length:577 Identity:129/578 (22%)
Similarity:227/578 (39%) Gaps:115/578 (20%)


Human    14 GHFGRFQR---VLYFICAFQN---ISCGIHYLASVFMGVTPHH---VCRPPGNVSQVVFHNHSNW 69
            |.:|::|.   :|.|:|...:   ::|      .:|....|.|   .|:||..:..   .|.:.|
  Fly   214 GPWGKWQLRTVLLIFLCKIPSSWFMAC------IIFTAPAPRHGEFFCKPPHTIGA---QNQTQW 269

Human    70 SLEDTGALLSSGQKDYVTVQLQNGEIWELSRCS--RNKRENTSSLGYEYTGSKKE---------- 122
                  ..:|..||:.     .:.:.:.:..|:  ::.:|:.... |.|..|.:|          
  Fly   270 ------IKVSHPQKEE-----SDDQEFSIDFCNVYQDAQEHAHHY-YNYENSDQEPRVWEKPLHR 322

Human   123 ----FPCVDGYIYDQNTWKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSV----TFGYFSDRL 179
                .||.:   :...:...:.|||::|||.|..|..:.|...:||||.|.:    ...|||.  
  Fly   323 NSNVIPCTE---FQHESDYHSVVTQYDLVCSRDILVSVTQFFHLFGVLTGGILANQLLKYFSP-- 382

Human   180 GRRVVLWATSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTWASV 244
             |.|:|:...:.:|. |........|...:..|...|:..:.....|...:.:..|.|.||..|.
  Fly   383 -RNVMLFGMITQIFC-GNLTGHVASYELHVFFRCLSAVCCAQMYTAGGQIMADITGGKYRTCVST 445

Human   245 HLHSFFAVGTLLVALTGYLVRTWWLYQMILSTVTVPFILCCWVLPETPFWLLSEGRYEEAQKIVD 309
            ....|:::|.:::........:|....|.:|..||..|.....:|::|.||::.||.::|:||: 
  Fly   446 LFEQFWSIGVMMLPGVASFWSSWSHLYMAISWPTVILIYLWQWIPDSPRWLIARGRTQDAKKIL- 509

Human   310 IMAKWNRASSCKLSELLSLDLQGPVSNSPTEVQKHNLSYLFYN----------WSITK------R 358
                           |..:::.|...|.|.::.: .|......          ||:.|      .
  Fly   510 ---------------LECVEVNGTGYNLPHDIDQ-QLELQAQTAMDAPPPSGWWSMWKGERAVRH 558

Human   359 TLTVWLIWFTGSLGFYSFSLNSVNLGGNE-YLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLA--Y 420
            .:.|.|.|....:.:|...||..:...:. |:|.|..|..|:....|....:.|..|:.:..  :
  Fly   559 IVCVHLAWSLYIVVYYGMLLNIRSFSRDHLYINTFFAGFSEMMGTFFGLFLILKTTRKWLWTGLF 623

Human   421 SLFCSALA-CGVVMVIPQKHYI-------LGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLA 477
            ::....:| ||  .::|:...|       |.:.:|||.|.||.....::...|.||.....:.:.
  Fly   624 NIVAGCIAYCG--WLVPKPSVIGLDPNVALLMCSAMVSKMAISTTLSILTTCTVELVSDDKKKIT 686

Human   478 VGSGSMVC--RLASILAPFSVDLSSIWIF---IPQLFVGTMALLSGVLT--LKLPET 527
              |.|.:|  |...:.|||   :.|..:|   |||....::|:|.|:.|  :..|.|
  Fly   687 --SFSTICWARFWLLGAPF---IGSTVVFGQLIPQTAFASLAILGGLCTSLISSPRT 738

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 129/578 (22%)
CG44098NP_001262264.1 2A0119 214..730 CDD:273328 126/568 (22%)
MFS 353..733 CDD:119392 94/408 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109625466
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.