DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG7458

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_649374.1 Gene:CG7458 / 40441 FlyBaseID:FBgn0037144 Length:572 Species:Drosophila melanogaster

Alignment Length:576 Identity:165/577 (29%)
Similarity:266/577 (46%) Gaps:82/577 (14%)


Human     7 EGIYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHH-----VCRPPGNVSQ------ 60
            :.|...:|.|||:|.:.|.:.....:......::.||...|..|     .|..|.:|.:      
  Fly    39 DAILVRIGQFGRYQIINYVLLCVPMLFNAFFSISYVFTASTVVHRCTVPQCDSPSSVYEEDWLGF 103

Human    61 VVFHNHSNW--------SLED--TGALLSSGQ---KDYVTVQLQNGEIWELSRCSRNKRENTSSL 112
            .:...:|.|        ::.|  :|....|||   |:|.|:..:.        |.|:        
  Fly   104 TIPKKNSAWDDCHRYAANISDAISGYTDPSGQYCLKEYFTITSET--------CGRD-------- 152

Human   113 GYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSD 177
             :::...:|                 |..|::.:.|:.:|...::..:...|..:|....|||:|
  Fly   153 -FKFRDEEK-----------------TISTEFGIYCEDEWKLSMVGTINNVGQFVGIPLGGYFAD 199

Human   178 RLGRRVVLWATSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTWA 242
            |.|||.:|....|...|.|:..:.:.:|..|:...|....|.|......|:..:|.:|.|.|..|
  Fly   200 RYGRRTMLAVAGSVSALMGVIRSLSSNYSMFLVFEFLDMAVGSTLFPTAFLLAIELVGPKRRVAA 264

Human   243 SVHLHSFFAVGTLLVALTGYLVRTW-WLYQMILSTVTVPFILCCWVLPETPFWLLSEGRYEEAQK 306
            :..:..|:|:|...:......|:.| ||.:::.:...:. ||..|:|||:..||||:|..|:|..
  Fly   265 ATIITIFYALGEAFLGFLASQVQHWRWLLRVLYAPAVLQ-ILFLWILPESVRWLLSQGAEEKASN 328

Human   307 IVDIMAKWNR--ASSCKLSELLSLDLQGPVSNSPTEVQKHNLSY------LFYNWSITKRTLTVW 363
            ::...|:.|:  ....:|::||:       ||.....|.:...|      :|:    :.|.....
  Fly   329 VLRRAARINQRPLPEEQLNDLLT-------SNRQKLSQANESQYPIMRAVVFF----SLRIANCC 382

Human   364 LIWFTGSLGFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAYSLFCSALA 428
            |.|||.:|.....||||||||||:|.|..|.|.::||......:.||:||||..|..|:...|:.
  Fly   383 LCWFTHTLIALGLSLNSVNLGGNKYTNFMLNGFIQIPGLLLPLVIMDRVGRRHSLCASMLLCAIC 447

Human   429 CGVVMVIPQKHYILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSGSMVCRLASILAP 493
            .|....:|..:|...:...::||.||..:|.::|.:|:|::||.||:..:...|||.|:.|:|||
  Fly   448 MGASAAVPADNYAGSLALFLIGKLAITCSFQILYFFTSEIFPTNVRNTLLSLCSMVGRIGSMLAP 512

Human   494 FSVDLSSIWIFIPQLFVGTMALLSGVLTLKLPETLGKRLATTWEEAAKLESENESK 549
            .:..|:..:|:.||:...|.||:||.|||..|||..|.|.||.|||..|   |::|
  Fly   513 QTPLLAKYYIYAPQILFATFALISGFLTLAFPETADKVLPTTIEEARDL---NQAK 565

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 157/554 (28%)
CG7458NP_649374.1 2A0119 46..554 CDD:273328 157/554 (28%)
MFS 161..544 CDD:119392 125/395 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D386678at33208
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.