DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and SLC22A

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_649370.1 Gene:SLC22A / 40437 FlyBaseID:FBgn0037140 Length:568 Species:Drosophila melanogaster

Alignment Length:572 Identity:157/573 (27%)
Similarity:255/573 (45%) Gaps:66/573 (12%)


Human     7 EGIYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCR------PPGNVSQVVFHN 65
            :.|..|:|.|||||.:::.:.....:...:..:..||...|..|.|.      |..|    .:..
  Fly    28 DAILKHLGQFGRFQLIIFLLICLPMMFHAMFSVTYVFTAATVTHRCSVEECDLPGSN----YYEP 88

Human    66 HSNWSLEDTGALLSSGQKDYVTVQLQNGEIW--ELSRCSRNKRENTSSLGYEYTGSKKEFPCVDG 128
            |:|||:...|..|.|..: |...:|..   |  .:..||.:          .:|.:|:  .|.  
  Fly    89 HTNWSIPKNGKDLDSCNR-YTNSELPQ---WNHSVDICSAD----------HFTKNKE--ACA-- 135

Human   129 YIYDQNTWKSTAVT---QWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLWATSS 190
              :::..::...||   .:.:.||.:|...::..:...|...|....|:.:||.||       |.
  Fly   136 --HNEFVFRDDEVTISNDFGIFCDDEWKLSMVGTINNLGQFFGIPIGGFVADRYGR-------SF 191

Human   191 SMFLFGIAAA-------FAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTWASVHLHS 248
            |:.|.||..|       |:..|..|:...|...|.:|......||..:|.:|.|.|..|...:..
  Fly   192 SIALGGILGAVLGVIRSFSPSYGWFLVFEFLDNMTSSTLYSTCFVIGIELVGPKRRVLACSVITV 256

Human   249 FFAVGTLLVALTGYLVRTWWLYQMILSTVTVPFILCCWVLPETPFWLLSEGRYEEAQKIVDIMAK 313
            |:|||.:|:|::......|.:...|....::..:...|:|||:..||||:|:.|.|:.|:     
  Fly   257 FYAVGEVLLAMSAKAFHDWRILLRITYGPSLILLAYFWILPESVRWLLSQGKEERAKNIL----- 316

Human   314 WNRASSCKLSELLSLDLQGPVSNSPTEVQKHNLS-------YLFYNWSITKRTLTVWLIWFTGSL 371
             .||:.....||....|...|..:..::|:.:.|       :..:.|.|...:    |.|....|
  Fly   317 -RRAAHVNKRELPESVLDKLVLANRDKLQQSSESRFPIREAFKNFKWRIANCS----LCWIVHVL 376

Human   372 GFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAYSLFCSALACGVVMVIP 436
            .:|..|||.|.|.|::|.|...:.:||||.:....:.||:.|||..|...:..|.|.|...:...
  Fly   377 VYYGLSLNVVLLDGDKYNNFAYIALVEIPGFFMPLLIMDRFGRRYSLCGLMLASGLCCIGTIFTG 441

Human   437 QKHYILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSGSMVCRLASILAPFSVDLSSI 501
            ....:|.:|..:|||..|.|:|.::|.:.:|:|||.:|:..:...||:.|..|:|||.:..|:..
  Fly   442 ADQPVLQLVLFLVGKLTITASFQVLYFFASEIYPTNLRNSLLSFCSMMGRFGSMLAPQTPLLAKY 506

Human   502 WIFIPQLFVGTMALLSGVLTLKLPETLGKRLATTWEEAAKLESENESKSSKL 553
            :...|.:.....|::||:|||..|||....|.||.:||..:..:.:|||..|
  Fly   507 YANAPAMLFAGAAIVSGLLTLFFPETTNVVLPTTVQEADAIGVKKQSKSKDL 558

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 148/546 (27%)
SLC22ANP_649370.1 2A0119 35..540 CDD:273328 148/546 (27%)
MFS 146..530 CDD:119392 115/401 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D386678at33208
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.