DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG5592

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_647996.1 Gene:CG5592 / 38662 FlyBaseID:FBgn0035645 Length:540 Species:Drosophila melanogaster

Alignment Length:571 Identity:134/572 (23%)
Similarity:250/572 (44%) Gaps:89/572 (16%)


Human     6 FEGIYDHVGHFGRFQ-RVLY------FICAFQNISCGIHYLASVFMGVTP-HHVCRPPGNVSQVV 62
            :|.....:|.||.|| |:|:      |:.||.       |...:||.:.| :|.||         
  Fly     9 YENFLLFIGDFGPFQKRLLFWMMPAAFLFAFT-------YFGQIFMILLPKNHWCR--------- 57

Human    63 FHNHSNWSLEDTGALLSSGQKDYVTVQLQNGEIWELSRCSRNKRENTSSLGYEYTGSKKEFPCVD 127
                    :.:...|..|.||:....:.|:|   ....|........|:...:...::...||.:
  Fly    58 --------VRELEGLPESEQKNRGIPKKQDG---SFENCFMYNVPYDSNATNDANQTRSPIPCNN 111

Human   128 GYIYDQN--TWKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLWATSS 190
            |:|||:.  .::|.| |::|.|||::........::..|.::|.:.||:.:|..||...|:..:|
  Fly   112 GWIYDRKEVPYESIA-TEYNWVCDKRDFGTYSVVVYFVGCIVGCLCFGFITDHSGRLPALFLANS 175

Human   191 SMFLFGIAAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTW-ASVHLHSFFAVGT 254
            ...:.|..:....|:..|.|:||...:..:...|..::..:|.:|:|.||. .::.|..||.:|.
  Fly   176 CSMIGGCVSVVCKDFPCFAASRFVAGLSMNYCFVPIYILTLENVGIKYRTLVGNLALTFFFTLGA 240

Human   255 LLVALTGYLVRTWWLYQMILSTVTVPFILCCWVLPETPFWLLSEGRYEEAQKIVDIMAK------ 313
            .|:....|::..|..|.|:::...|..||...:.||:|.||:|.|:.:...:::...||      
  Fly   241 CLLPWLAYVISNWRHYAMVVALPIVFMILTSLLAPESPSWLMSVGKVDRCIEVMKEAAKANGKII 305

Human   314 ----WNRASSC---KLS------ELLSLDLQGPVSNSPTEVQKHNLSYLFYNWSITKRTLTVWLI 365
                |:....|   |.:      :..||||   ....|..|                 .||:.::
  Fly   306 SEEVWSEMRECYELKFANEQLGKQYTSLDL---FKTFPRLV-----------------VLTILIV 350

Human   366 -WFTGSLGFYSFSLNSVN-LGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVL-AYSLFC--S 425
             |.|.:|. |...:..|. |..:.::...|..:|||||.....:.:|::||:.:: |..|.|  |
  Fly   351 TWMTVALA-YDAHVRVVEILDTDIFITFSLSSLVEIPAGIVPMLLLDRIGRKPMMSAVMLLCAAS 414

Human   426 ALACGVVMVIPQKHYILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSGSMVCRLASI 490
            :|..|::     |.:......|:..:|....|:.:...:.:|:.||::|...:...:::.::.::
  Fly   415 SLFVGIL-----KGHWNASTAAIAARFFATMAYNVGQQWASEILPTVLRGQGLAIINIMGQMGAL 474

Human   491 LAPFSVDLSSIWIFIPQLFVGTMALLSGVLTLKLPETLGKRLATTWEEAAK 541
            |:|..:.....:..:|...:..::::..::.|.||||.|..:..|.:||.|
  Fly   475 LSPLVLSTHRYYRPLPMFIITLVSVIGALIILFLPETKGATMPQTLDEAEK 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 129/556 (23%)
CG5592NP_647996.1 2A0119 17..519 CDD:273328 129/556 (23%)
MFS 141..509 CDD:119392 87/394 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C59538246
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.