DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG8654

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_001246441.1 Gene:CG8654 / 37275 FlyBaseID:FBgn0034479 Length:502 Species:Drosophila melanogaster

Alignment Length:534 Identity:146/535 (27%)
Similarity:240/535 (45%) Gaps:71/535 (13%)


Human     9 IYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPGNVSQVVFHNHSNWSLED 73
            |...:|.|.|:|...:||........|.|.|..:|:.......|                     
  Fly    24 IISQIGDFRRYQLFFFFIVLLCKFGTGWHTLGHIFLAAPTPLSC--------------------- 67

Human    74 TGALLSSGQKDYVTVQLQNGEIWELSRCSRNKRENTSSLGYEYTGSKKEFPCVDGYI---YDQNT 135
                                           |.||.:.            ||.|...   :|.:.
  Fly    68 -------------------------------KTENVTD------------PCSDECSETEFDTSV 89

Human   136 WKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFGIAAA 200
            ::||.:|:|||.|:.|.||.|.|.:.|.|:|.||:.||.|:||.|||...........:.|:...
  Fly    90 FQSTIITEWNLTCESKQLASLSQSIVMLGILFGSILFGMFADRYGRRPAFLTCCFMQLITGLIVC 154

Human   201 FAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALTGYLVR 265
            .:..|:.:...||.:|:..:|.:...||.:||.:|.|.|...::.....|.:|...:||..|.:|
  Fly   155 VSPYYWFYCLFRFLVAVATAGTMTTSFVLLMEIVGPKKREMVAILYQIPFNIGHASLALFAYFIR 219

Human   266 TWWLYQMILSTVTVPFILCCWVLPETPFWLLSEGRYEEAQKIVDIMAKWNRASSCKLSELLSLDL 330
            .|..:|..::..::.|::..|::||:|.||.:.|:.:::.||::.:||.|:|.:..:...:....
  Fly   220 EWRWFQFSITIFSIVFVIYIWLVPESPRWLFTTGKLDKSIKILEKIAKCNKAPTETIRPEIEAAY 284

Human   331 QGPVSNSPTEVQKHNLSYLFYNWSITKRTLTVWLIWFTGSLGFYSFSLNSVNLGGNEYLNLFLLG 395
            ....:..|  |:|..:..||....:..:|:.:...|....:.:|..:.....||||.:::..:..
  Fly   285 GALAARQP--VKKGTVVDLFRTPYMRIKTIFMANNWLVVCMVYYGTAQYVSALGGNIFISNAIAA 347

Human   396 VVEIPAYTFVCIAMDK-VGRRTVLAYSLFCSALACGVVMVIPQKHYILGVVTAMVGKFAIGAAFG 459
            .|.||. |.:|..|.| :||:..|..|..||||...::..:..:...:.|..|.:|.|.....|.
  Fly   348 GVGIPG-TCLCALMTKYLGRKKTLLLSNGCSALGLILLACLSTQAEAVRVTCATIGLFGASITFP 411

Human   460 LIYLYTAELYPTIVRSLAVGSGSMVCRLASILAPFSVDLSSIWIFIPQLFVGTMALLSGVLTLKL 524
            .:|||..||:||:|||..||..|||.|:.||:||..|||::..:::..|..|..::|:.:.|:.|
  Fly   412 NVYLYGGELFPTVVRSSGVGLCSMVGRIGSIVAPLIVDLAAYGLWVAPLIFGIFSILAMLGTIFL 476

Human   525 PETLGKRLATTWEE 538
            |||.|..|..|.|:
  Fly   477 PETRGTPLPETLED 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 143/525 (27%)
CG8654NP_001246441.1 SP 85..487 CDD:273317 126/405 (31%)
MFS 87..477 CDD:119392 120/393 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D386678at33208
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1933
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.