DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG4630

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_001260948.1 Gene:CG4630 / 36458 FlyBaseID:FBgn0033809 Length:582 Species:Drosophila melanogaster

Alignment Length:591 Identity:176/592 (30%)
Similarity:282/592 (48%) Gaps:79/592 (13%)


Human     6 FEGIYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPGNVSQVVFHNHSNW- 69
            |:.|...:|.||||||..|.:.....:....:.|:.||...:|.:.|..|.....|.....:|| 
  Fly    15 FDDILVEIGEFGRFQRRNYLLICLPVLFAAANSLSYVFTAGSPTYRCYVPECDKLVDAEYGANWV 79

Human    70 SLEDTGALLSSGQKDYVTVQ--LQNGE----------IWELSRCSRNKRENTSSLGYEYTGSKKE 122
            |:...|:....|.....|.:  :.||:          .|.|.:|.   .||.::          |
  Fly    80 SIAVPGSWSKRGHFTPSTCERFVANGDHLESSSDPWSAWPLDQCF---AENFTT----------E 131

Human   123 FPCVDGYIYDQNTWKSTAVTQWNLVC-DRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLW 186
            ....:.::|..:  :.|.|.||.|.| :..|....:..:...|:::|:...||.:||.||:.:..
  Fly   132 TERCNQFVYGSS--ERTIVQQWGLQCPENLWKLAFVGTIHFAGLVVGTALSGYLADRYGRKHIFL 194

Human   187 ATSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTWASVHLHSFFA 251
            .....|.|.|:|.|.:.||.:|:......|:..||...:.|:..:|.:|.:.|..:|:.|:.|:|
  Fly   195 FCIVFMALTGVAQALSWDYISFLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMSSIVLNYFYA 259

Human   252 VGTLLVALTGYLVRTWWLYQMILSTVTVPFILCC---WVLPETPFWLLSEGRYEEAQKIVDIMAK 313
            ||..|:.|:.:| ..|...|:.||   ||.::|.   |::||:..|||:..|.|:|..|:...||
  Fly   260 VGEALLGLSVFL-PDWRQLQLALS---VPPLICVAYFWLVPESVRWLLARNRREQAGVIIRRAAK 320

Human   314 WNR-------ASSCKLSEL-----LSLDLQGPVSNSPTEVQKHNLSYLFY-----NWSITKRTLT 361
            .||       .:|.|..||     ...|::|.:     .|:|.:..:|..     :..:..|...
  Fly   321 VNRRDISVELMASFKQQELDAETGQEDDVEGGL-----HVKKDDKIWLAVKEVARSHILMGRYAI 380

Human   362 VWLIWFTGSLGFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAYSLFCSA 426
            :.|||...::.:|..|||:.:|.||:|||..|:.:||||.|:...:.:.:.|||..|:.||...:
  Fly   381 LLLIWAVNAIVYYGLSLNATSLSGNKYLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGSLLLCS 445

Human   427 LAC---GVVMVIPQKHYI-----------------LGVVTAMVGKFAIGAAFGLIYLYTAELYPT 471
            :.|   |.| .:.|..:|                 |.|...:|||..|.::|.:||.:|||:.||
  Fly   446 ITCVASGFV-TLAQGDWIPCQTGVESRHSWSCANWLVVTLFLVGKLGITSSFAVIYTFTAEMMPT 509

Human   472 IVRSLAVGSGSMVCRLASILAPFSVDLSSIWIFIPQLFVGTMALLSGVLTLKLPETLGKRLATTW 536
            ::||..||..|...|..::||||...|:|.:..:|.|..||::|::|:|:|.||||..::|..|.
  Fly   510 VIRSGGVGVMSTFARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLLSLLLPETFNRKLPDTV 574

Human   537 EEAAKL 542
            |||..|
  Fly   575 EEAIAL 580

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 169/575 (29%)
CG4630NP_001260948.1 2A0119 23..573 CDD:273328 169/575 (29%)
MFS 158..533 CDD:119392 118/385 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D386678at33208
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24064
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.