DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG31272

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_650013.3 Gene:CG31272 / 326130 FlyBaseID:FBgn0051272 Length:563 Species:Drosophila melanogaster

Alignment Length:464 Identity:96/465 (21%)
Similarity:179/465 (38%) Gaps:115/465 (25%)


Human   164 GVLLGSVTFGYFSDRLGRRVVL-WA-TSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYLVVG 226
            |:.:.::.:||.:|..||:.:| |. ...::.:||  :|.:.::...:..:|...:|.:|...|.
  Fly   107 GMTISAIAWGYLADTKGRKKILYWGYLIDAVCVFG--SALSQNFSMLVMFKFLGGLVVNGPAAVL 169

Human   227 FVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALT----GYLVRTW----W-----LYQMILSTVT 278
            |.|:.|..|.|.|  :||.:.......|..|:|.    |...|.|    |     .:|:.|..:.
  Fly   170 FTYLTEMHGPKHR--SSVLMIVGMVTSTATVSLPLLAWGIFPRDWDFEFWGLQVHSWQIFLFVLG 232

Human   279 VP-----FILCCWVLPETPFWLLSEGRYEEA---------------------------------- 304
            :|     .|.|.  :||:|.:|:::||.|||                                  
  Fly   233 IPSLISGLIFCS--MPESPRFLMAQGRNEEALQAFKQIYHVNTRKPKDSYPIKALIQEVPNRKAA 295

Human   305 --QKIVDIMAKWNRASSCKLSELLSLDLQGPVSNSPTEVQKHNLS-----YLF-YNWSITKRTLT 361
              :.|..|..|.....:.:.|..|:..|:..:......|:|..|.     |:. :...:...|:.
  Fly   296 QNEVIYTIEEKSGEVPTKRQSRTLAESLRAGLQQMKPLVRKPLLGLAICCYVMQFGIFLGMNTIR 360

Human   362 VWLIWFTGSLGFY-----------------SFSLN-----SVN----------LGGNEYLNLFLL 394
            :||.....|:..|                 .||:|     ::|          :..:.|||..::
  Fly   361 LWLPQLFASMAEYEALHAGDGLDVSMCTILEFSVNQTAETALNYADACSEPKVISMDMYLNNIIV 425

Human   395 GVVEIPAYTFVCIAMDKVGRRTVLAYSLFCSALACGVVMVIPQKHYILGVVTA---MVGKFAIGA 456
            .......|.|....:..:|.:.::.|.||.|. ..|:::.......:..:|:|   .:...|:.:
  Fly   426 SATGFVGYFFAGGILRALGPKRMMTYGLFLSG-TFGLMLYFSVSSLMTLIVSATFLTITGIAVSS 489

Human   457 AFGLIYLYTAELYPTIVRSLAVGSGSMVCRL----ASILAPFSVDLSSIWIFIPQLFVGTMALLS 517
            ..|.:    ..|:||.:|::.|....|..|.    .::|.|..|....:   .|.:.|.::.:||
  Fly   490 LLGAV----VALFPTQLRTVVVAIAMMCGRFGALSGNLLFPVFVQTGCL---PPFIMVSSVLILS 547

Human   518 GVLTLKLPE 526
            |:|::.||:
  Fly   548 GILSISLPD 556

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 96/465 (21%)
CG31272NP_650013.3 MFS 62..555 CDD:119392 95/462 (21%)
2A0115 74..524 CDD:273327 85/428 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C100806340
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.