DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A16 and CG15221

DIOPT Version :8

Sequence 1:NP_149116.2 Gene:SLC22A16 / 85413 HGNCID:20302 Length:577 Species:Homo sapiens
Sequence 2:NP_001096957.1 Gene:CG15221 / 32127 FlyBaseID:FBgn0030331 Length:545 Species:Drosophila melanogaster

Alignment Length:499 Identity:115/500 (23%)
Similarity:191/500 (38%) Gaps:124/500 (25%)


Human   148 CDRKWLAMLIQPLF----------MFGVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFGIAAAFA 202
            ||       :||..          ..||:|.|...|:.:|..||...|........:..|.:||:
  Fly    77 CD-------LQPTLNQQGILASAGFLGVVLSSHAMGFLADTWGRATTLRYALCISSVCSIVSAFS 134

Human   203 VDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTWASVHLHSF----------FAVGTLLV 257
            |:.:..:..||......||.....|....||.|..||......|..|          .|:|.|.:
  Fly   135 VNIWMLIVFRFLTGFFISGGQACVFSLCGEFHGTGSRIRHVTLLSGFLCMAMIFAPAMAIGILPL 199

Human   258 AL----TGYLVRTWWLYQMILSTVTVPFILCCWV--LPETPFWLLSEGRYEEAQKIVDIMAKWNR 316
            .:    .|....:|.:  ::|:.|::|.:....:  |||||.:||.:||.:|:.:::..:...|.
  Fly   200 RIETIVLGMHFSSWRV--LLLANVSIPLLALVGISALPETPKYLLVQGRGDESLEVLRSIFANNS 262

Human   317 A---SSCKLSELLSLDLQGPVSNS-------PTEVQKHNLSYLFYN---WSITKRTLTVWLI--- 365
            .   |...:.| ::|: .|.||.|       ...:..|....|||.   |    .||.:..|   
  Fly   263 GRDPSEYPVKE-VALE-SGGVSLSDVHGFLDAVRLVWHQTVPLFYRARLW----HTLNICCIQFI 321

Human   366 ----------WF---TGSLG------------FYSFSLN----------SVNLGGNEYLNLFLLG 395
                      ||   ...||            ...|::|          ||.:..:.|..:.::.
  Fly   322 IYFLAQGIFMWFPTILDELGTRNGENTLLCTVLQGFNINSSSEDEASSCSVEVDTSTYQVMIIIA 386

Human   396 VVEIPAYTFVCIAMDKVGRRTVL-AYSLFCSALACGVVMVIPQKHYI---LGVVTAMVGKFAIGA 456
            ...:..|......:|.:|::.:| |:.:.  .:.|.|.:     ||:   ..||.|:....|||.
  Fly   387 ACFVVIYLIFAYIIDYMGKKNLLMAWMVL--TMICLVAL-----HYVEQFALVVIALTVVMAIGN 444

Human   457 AFGLIYLYTAELYPTIVRSLAVGSGSMVCRLASILAPFSVDLSSIWIFIPQLFVGT-----MALL 516
            ..||:.....|.|||.:.::.:....||.||.:::.      |:|   :.:|...:     .|||
  Fly   445 CGGLVSTIAMEFYPTHINAMGMCFIMMVGRLGAVVG------SNI---LGRLLFASCDPIFWALL 500

Human   517 SGVLTLKLPETLGKRLATTWEEAAKLESENESKSSKLLLTTNNS 560
            :.|:.|.   |||..|    .|.|:.:.:..|.::|.::|...|
  Fly   501 ALVVLLC---TLGYFL----PEKARSQQKKPSATAKAIVTATTS 537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC22A16NP_149116.2 Sugar_tr 14..535 CDD:331684 109/473 (23%)
CG15221NP_001096957.1 2A0115 36..488 CDD:273327 100/442 (23%)
MFS 51..488 CDD:119392 100/442 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62667333
eggNOG 1 0.900 E1_KOG0255
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.